Property Summary

NCBI Gene PubMed Count 37
Grant Count 12
R01 Count 5
Funding $2,199,102
PubMed Score 143.13
PubTator Score 21.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
ependymoma -1.200 0.035
oligodendroglioma -1.300 0.017
Duchenne muscular dystrophy 1.624 0.000
limb girdle muscular dystrophy 2A 1.256 0.000
Becker muscular dystrophy 1.319 0.000
juvenile dermatomyositis 1.524 0.000
pancreatic ductal adenocarcinoma liver m... 2.613 0.001
pancreatic cancer 1.800 0.000
lung cancer -3.500 0.043
diabetes mellitus -1.800 0.005
lung carcinoma -1.500 0.000
pituitary cancer -1.200 0.000
dermatomyositis 1.100 0.019

Gene RIF (20)

PMID Text
25037578 High expression of thymosin beta 10 is associated with hepatocellular carcinoma.
24974154 High expression levels of TMSB10 correlated with lymphatic metasttases in papillary thyroid carcinoma, especially in the central neck region.
24854554 Tbeta10 human recombinant proteins promoted the expression of VEGF-C by activating AKT phosphorylation in lung cancer cell lines.
24704991 Regarding HCC, Tbeta4 reactivity was detected in 7/23 cases (30%) and Tbeta10 reactivity in 22/23 (97%) cases analyzed, adding HCC to human cancers that express these beta-thymosins.
24053380 Low expression of Tbeta10 is associated with metastatic phenotype of CCA in vitro and in vivo.
22623951 Thymosin beta10 expression driven by the human TERT promoter induces ovarian cancer-specific apoptosis through ROS production.
22161024 Amplification of thymosin beta 10 is associated with metastatic and aggressive papillary thyroid carcinomas.
22038593 hypomethylation of the promoter is not associated with its overexpression in non-small cell lung cancer
21733645 The results show, for the first time, a strong expression of thymosin beta 10 in the human salivary glands during the initial phases of the physiological development, present at the 13th week of gestation, and suggesting a role for the peptide in the salivary glands' organogenesis.
21314931 Describe beta-thymosins in bronchoalveolar lavage fluid and their possible involvement in the pathogenesis of scleroderma lung disease.
More...

AA Sequence

MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS                                1 - 44
//

Text Mined References (45)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25037578 2014 High expression of thymosin beta 10 predicts poor prognosis for hepatocellular carcinoma after hepatectomy.
24974154 2014 Thymosin beta 10 correlates with lymph node metastases of papillary thyroid carcinoma.
24854554 2014 [Thymosin beta 10 prompted the VEGF-C expression in lung cancer cell].
24704991 2014 Thymosin beta 4 and thymosin beta 10 expression in hepatocellular carcinoma.
24053380 2013 Suppression of thymosin ?10 increases cell migration and metastasis of cholangiocarcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22623951 2012 Thymosin ?10 expression driven by the human TERT promoter induces ovarian cancer-specific apoptosis through ROS production.
22161024 2012 Amplification of thymosin beta 10 and AKAP13 genes in metastatic and aggressive papillary thyroid carcinomas.
More...