Property Summary

NCBI Gene PubMed Count 38
PubMed Score 149.82
PubTator Score 21.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Becker muscular dystrophy 1.319 4.6e-05
dermatomyositis 1.100 1.9e-02
diabetes mellitus -1.800 4.7e-03
Duchenne muscular dystrophy 1.624 9.9e-11
ependymoma -1.200 3.5e-02
juvenile dermatomyositis 1.524 8.8e-13
limb girdle muscular dystrophy 2A 1.256 5.8e-08
lung cancer -3.500 4.3e-02
lung carcinoma -1.500 4.3e-23
oligodendroglioma -1.300 1.7e-02
pancreatic cancer 1.200 3.3e-05
pancreatic ductal adenocarcinoma liver m... 2.613 6.6e-04
pituitary cancer -1.200 2.9e-05

Gene RIF (21)

AA Sequence

MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS                                1 - 44
//

Text Mined References (46)

PMID Year Title