Property Summary

NCBI Gene PubMed Count 20
Grant Count 5
R01 Count 4
Funding $613,955.25
PubMed Score 68.89
PubTator Score 19.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.035 0.001
astrocytic glioma -1.300 0.025
oligodendroglioma -1.100 0.034
cutaneous lupus erythematosus -1.100 0.006
group 3 medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.800 0.000
tuberculosis 1.100 0.000
adult high grade glioma -1.100 0.002
ovarian cancer 1.900 0.000

Gene RIF (11)

PMID Text
26474786 SelW may have a regulatory function in redox cell signaling by interacting with 14-3-3 protein.
25721765 Suppression of EGFR ubiquitination by SEPW1 may be related to the putative increase in cancer risk associated with high selenium intakes.
23830627 In response to selenium compounds, SepW1 synthesis increased at the protein and the mRNA levels.
22730327 SEPW1 silencing increases MKK4, which activates p38gamma, p38delta, and JNK2 to phosphorylate p53 on Ser-33 and cause a transient G(1) arrest.
21875573 The present work shows that SEPW1 facilitates the G1 to S-phase transition by down-regulating expression of the cyclin-dependent kinase inhibitor p21
21866568 p53 was increased in SEPW1 silenced cells and was inversely correlated with SEPW1 mRNA in cell lines with altered SEPW1 expression.
19690192 The small interfering RNA knockdown of BNIP3, IER3, and SEPW1 genes affected critical multiple myeloma endothelial cell functions correlated with the overangiogenic phenotype
19387567 SEPW1 mRNA levels were maximal during G1-phase, dropped after the G1/S transition and increased again after G2/M-phase.
15823556 SeW is the novel molecular target of MeHg in human neuronal cells and down-regulation of this selenoenzyme by MeHg is dependent not on generation of ROS but on depletion of GSH.
15670848 SelW expression in the colon is highly sensitive to Se-depletion
More...

AA Sequence

MALAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKKKGDGYVDTE      1 - 70
SKFLKLVAAIKAALAQG                                                          71 - 87
//

Text Mined References (22)

PMID Year Title
26474786 2016 Identification of a redox-modulatory interaction between selenoprotein W and 14-3-3 protein.
25721765 2015 Selenoprotein W controls epidermal growth factor receptor surface expression, activation and degradation via receptor ubiquitination.
23830627 2013 Selenoprotein W as biomarker for the efficacy of selenium compounds to act as source for selenoprotein biosynthesis.
22730327 2012 Delayed cell cycle progression in selenoprotein W-depleted cells is regulated by a mitogen-activated protein kinase kinase 4-p38/c-Jun NH2-terminal kinase-p53 pathway.
21875573 2011 Delayed cell cycle progression from SEPW1 depletion is p53- and p21-dependent in MCF-7 breast cancer cells.
21866568 2012 Selenoprotein W depletion induces a p53- and p21-dependent delay in cell cycle progression in RWPE-1 prostate epithelial cells.
19690192 2009 Gene expression profiling of bone marrow endothelial cells in patients with multiple myeloma.
19387567 2009 Selenoprotein W modulates control of cell cycle entry.
17503775 2007 SelT, SelW, SelH, and Rdx12: genomics and molecular insights into the functions of selenoproteins of a novel thioredoxin-like family.
15823556 2005 Selenoprotein W as molecular target of methylmercury in human neuronal cells is down-regulated by GSH depletion.
More...