Property Summary

NCBI Gene PubMed Count 21
PubMed Score 70.66
PubTator Score 19.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 1.9e-03
astrocytic glioma -1.300 2.5e-02
cutaneous lupus erythematosus -1.100 6.2e-03
group 3 medulloblastoma -1.400 2.9e-05
medulloblastoma, large-cell -1.300 3.8e-04
Multiple myeloma 1.035 5.4e-04
oligodendroglioma -1.100 3.4e-02
ovarian cancer 1.900 1.4e-04
tuberculosis 1.100 2.6e-08

Gene RIF (11)

AA Sequence

MALAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKKKGDGYVDTE      1 - 70
SKFLKLVAAIKAALAQG                                                          71 - 87
//

Text Mined References (23)

PMID Year Title