Property Summary

NCBI Gene PubMed Count 217
Grant Count 136
R01 Count 76
Funding $13,313,174.67
PubMed Score 253.99
PubTator Score 257.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.143 0.003
Multiple myeloma 1.156 0.001
psoriasis -1.600 0.000
osteosarcoma 2.986 0.000
sonic hedgehog group medulloblastoma 1.400 0.000
glioblastoma 1.400 0.023
medulloblastoma, large-cell -1.200 0.010
tuberculosis and treatment for 6 months 1.100 0.000
non-small cell lung cancer -1.236 0.000
lung cancer -1.300 0.042
atypical teratoid/rhabdoid tumor 1.100 0.000
invasive ductal carcinoma -1.400 0.040
inflammatory breast cancer -1.300 0.001
ovarian cancer -2.700 0.000
pituitary cancer -1.100 0.000

Synonym

Accession P63279 D3DU69 P50550 Q15698 Q59GX1 Q86VB3
Symbols P18
UBC9
C358B7.1

Gene

PDB

4Y1L   5D2M   1A3S   1KPS   1Z5Q   1Z5S   2GRN   2GRO   2GRP   2GRQ   2GRR   2O25   2PE6   2PX9   2XWU   3A4S   3UIN   3UIO   3UIP   4W5V   5F6D   5F6E   5F6U   5F6V   5F6W   5F6X   5F6Y  

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
2006 confirmatory 1039 / 181 / 289855 uHTS HTRF assay for identification of inhibitors of SUMOylation
2011 summary 0 / 0 / 0 Summary assay for identification of inhibitors of SUMOylation
2018 confirmatory 602 / 0 / 631 AlphaScreen confirmatory assay for validation of inhibitors of SUMOylation
2069 screening 207 / 0 / 1026 uHTS HTRF interference counterscreen assay for validation of inhibitors of SUMOylation
2614 confirmatory 85 / 0 / 28 SAR analysis of SUMOylation using HTRF in an in-Vitro dose response assay
485337 confirmatory 16 / 0 / 15 SAR analysis of SUMOylation using HTRF in an in-Vitro dose response assay - Set 2
485393 confirmatory 50 / 0 / 4 SAR analysis of the MOA of E2 SUMOylation inhibitors in an HTRF format

Gene RIF (107)

PMID Text
27030546 Suggest a novel role of PCGF2 in arsenic trioxide-mediated degradation of PML-RARA that PCGF2 might act as a negative regulator of UBE2I via direct interaction.
26697886 Characterization and Structural Insights into Selective E1-E2 Interactions in the Human and Plasmodium falciparum SUMO Conjugation Systems.
26524494 The authors show that ZNF451 is SUMO2 specific and that SUMO modification of ZNF451 may contribute to activity by providing a second molecule of SUMO that interacts with E2.
26192107 a high-throughput microscopy screen identified ubiquitin carrier protein 9 (Ubc9) as a negative regulator of energy storage in human sc adipocytes. Ubc9 depletion enhanced energy storage and induced the brown fat gene program in human sc adipocytes.
25918163 The RWD domain binds to a Ubc9 surface that also must interact with E1, E3, and SUMO.
25867063 Akt directly phosphorylates Ubc9 at Thr35 and phosphorylates SUMO1 at Thr76. Ubc9 phosphorylation at Thr35 promotes Ubc9 thioester bond formation and SUMO1 phosphorylation at Thr76 stabilizes the SUMO1 protein.
25805818 SUMO E2 ligase Ubc9 has a critical role in oncogenesis driven by the Ras/Raf pathway
25637535 N-terminal amino acid residues of Ubc9 are critical for Ubc9 nuclear enrichment and localization.
25586181 Data indicate that protein tyrosine phosphatase 1B (PTP1B) association with calnexin is ubiquitin conjugating enzyme 9 (UBC9)-dependent.
24753249 Although E2 approximately SUMO-1 exhibits no specificity for product-bound TDG, the relatively high conjugation efficiency raises the possibility that E2-mediated sumoylation could stimulate product release in vivo.
More...

AA Sequence

MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPS      1 - 70
SPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN     71 - 140
RVEYEKRVRAQAKKFAPS                                                        141 - 158
//

Text Mined References (236)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27030546 2016 PCGF2 negatively regulates arsenic trioxide-induced PML-RARA protein degradation via UBE2I inhibition in NB4 cells.
26697886 2016 Characterization and Structural Insights into Selective E1-E2 Interactions in the Human and Plasmodium falciparum SUMO Conjugation Systems.
26524494 2015 Structural basis for catalytic activation by the human ZNF451 SUMO E3 ligase.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26192107 2015 Ubc9 Impairs Activation of the Brown Fat Energy Metabolism Program in Human White Adipocytes.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25918163 2015 RWD Domain as an E2 (Ubc9)-Interaction Module.
25867063 2016 SUMO modification of Akt regulates global SUMOylation and substrate SUMOylation specificity through Akt phosphorylation of Ubc9 and SUMO1.
25805818 2015 Oncogenesis driven by the Ras/Raf pathway requires the SUMO E2 ligase Ubc9.
More...