Property Summary

NCBI Gene PubMed Count 36
Grant Count 67
R01 Count 61
Funding $8,006,575.32
PubMed Score 41.70
PubTator Score 17.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.097 0.003
psoriasis -1.600 0.000
osteosarcoma -1.384 0.000
pancreatic ductal adenocarcinoma liver m... -1.313 0.001
lung cancer 1.100 0.006
Breast cancer 1.800 0.045
ovarian cancer 1.100 0.001
pituitary cancer 1.100 0.000

Synonym

Accession P63272 B2R4X8 D3DTZ4 Q16550 Q62387 Q6ZP89 hSPT4
Symbols SPT4
SPT4H
SUPT4H
Supt4a

Gene

PDB

3H7H  

Gene RIF (11)

PMID Text
27516603 Knockdown of SUPT4H1, the human Spt4 ortholog, similarly decreased production of sense and antisense RNA foci, as well as dipeptide repeat proteins, in patient cells.
22422068 The SPT5/SPT4 complex, DSIF, associates with the HIV-1 transcription elongation complex (TEC) and are involved in the activation of transcriptional elongation by HIV-1 Tat
19952111 he Paf1 complex (Paf1C) and Tat-SF1, two factors implicated previously in elongation control, collaborate with DSIF to facilitate efficient elongation
19860741 crystal structure of hSpt4 in complex with the dimerization region of hSpt5
19210550 These results suggest that one of the functions of Spt5 is to suppress senescence and apoptosis, and that this function is exerted through its association with Spt4 and Pol II.
18373978 Spt4 was purified and characterized.
17962196 These findings reveal a dynamic regulation of DSIF involving either E-box or NF-kappaB depending on the physiological circumstances.
17502349 Upon induction of NF-kappaB, a subset of target genes is regulated differentially by either P-TEFb or DSIF.[P-TEFb, DSIF]
11112772 The SPT5/SPT4 complex, DSIF, associates with the HIV-1 transcription elongation complex (TEC) and are involved in the activation of transcriptional elongation by HIV-1 Tat
10757782 The SPT5/SPT4 complex, DSIF, associates with the HIV-1 transcription elongation complex (TEC) and are involved in the activation of transcriptional elongation by HIV-1 Tat
More...

AA Sequence

MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSW      1 - 70
VSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT                            71 - 117
//

Text Mined References (38)

PMID Year Title
27516603 2016 Spt4 selectively regulates the expression of C9orf72 sense and antisense mutant transcripts.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22570620 2012 The DSIF subunits Spt4 and Spt5 have distinct roles at various phases of immunoglobulin class switch recombination.
21269460 2011 Initial characterization of the human central proteome.
19952111 2009 DSIF, the Paf1 complex, and Tat-SF1 have nonredundant, cooperative roles in RNA polymerase II elongation.
19860741 2009 Crystal structure of the human transcription elongation factor DSIF hSpt4 subunit in complex with the hSpt5 dimerization interface.
19210550 2009 Role of human transcription elongation factor DSIF in the suppression of senescence and apoptosis.
More...