Property Summary

NCBI Gene PubMed Count 39
PubMed Score 43.43
PubTator Score 17.97

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 1.800 4.5e-02
lung cancer 1.100 5.9e-03
Multiple myeloma 1.097 3.4e-03
osteosarcoma -1.384 2.6e-04
ovarian cancer 1.100 1.3e-03
pancreatic ductal adenocarcinoma liver m... -1.313 6.6e-04
pituitary cancer 1.100 3.9e-06
psoriasis -1.600 4.5e-05

Protein-protein Interaction (1)

Gene RIF (12)

AA Sequence

MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSW      1 - 70
VSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT                            71 - 117
//

Text Mined References (41)

PMID Year Title