Property Summary

NCBI Gene PubMed Count 134
Grant Count 67
R01 Count 37
Funding $13,161,471.17
PubMed Score 207.30
PubTator Score 390.01

Knowledge Summary

Patent (4,865)

Expression

  Differential Expression (26)

Disease log2 FC p
gastric cancer 1.400 0.002
hepatocellular carcinoma 2.500 0.000
pancreatic cancer 2.100 0.000
malignant mesothelioma 1.800 0.000
astrocytic glioma -2.800 0.013
ependymoma -2.900 0.018
oligodendroglioma -2.400 0.024
cystic fibrosis 1.445 0.000
primitive neuroectodermal tumor -1.600 0.000
adrenocortical carcinoma 1.323 0.001
tuberculosis and treatment for 6 months -3.100 0.001
intraductal papillary-mucinous adenoma (... -2.100 0.008
lung cancer 1.600 0.000
sarcoidosis 1.400 0.031
interstitial cystitis 1.800 0.000
sonic hedgehog group medulloblastoma -1.900 0.000
pancreatic carcinoma 2.100 0.000
lung adenocarcinoma -1.200 0.000
Endometriosis -1.446 0.014
Breast cancer 3.200 0.044
ductal carcinoma in situ -1.500 0.005
invasive ductal carcinoma -1.400 0.004
ulcerative colitis -1.500 0.000
ovarian cancer -2.500 0.000
Down syndrome 1.100 0.002
psoriasis 1.200 0.000

Synonym

Accession P63252 O15110 P48049
Symbols IRK1
LQT7
SQT3
ATFB9
HHIRK1
KIR2.1
HHBIRK1

Gene

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
623984 confirmatory 0 / 0 / 1 Activators of the GIRK family of Potassium Channels (hKir2.1_ThalliumFlux_CRC)

Gene RIF (101)

PMID Text
26710323 Patients with Dilated Cardiomyopathy and Sustained Monomorphic Ventricular Tachycardia Show Up-Regulation of KCNN3 and KCNJ2 Genes and CACNG8-Linked Left Ventricular Dysfunction
26663529 Variability has been found in a three-generation family with Pierre Robin sequence, acampomelic campomelic dysplasia, and intellectual disability due to a novel approximately 1 Mb deletion upstream of SOX9, and including KCNJ2 and KCNJ16.
26390131 Results indicate that silencing BKCa (KCa1.1) inhibits cell mobility, while silencing IKir (Kir2.1) increases cell mobility in human cardiac c-kit+ progenitor cells.
25885757 No genetic variants were identified in the KCNJ2 gene in this cohort of Chinese thyrotoxic periodic paralysis patients.
25880778 Upregulation of the inwardly rectifying potassium channel Kir2.1 (KCNJ2) modulates multidrug resistance of small-cell lung cancer under the regulation of miR-7 and the Ras/MAPK pathway.
25727015 propose that Kir2.1 currents control the interspike interval, and predict that blocking Kir2.1 channels increases the action potential frequency, which should augment the rate of insulin secretion in pancreatic beta cells
25205296 Kir2.1 channels exhibit a binding site determined by Cys311 that is responsible for drug-induced increases in inward rectifier Kir2.1 currents.
25205110 Kir2.1 channel function is essential during osteoblastogenesis.
24861851 This study demonistrated that KCNJ2 mutations cause a variable phenotype, with dysmorphic features seen in all patients studied, a high penetrance of periodic paralysis in males and ventricular arrhythmia with a risk of sudden cardiac death.
24794859 Results show that K346T mutation causes gain of function of the Kir2.1 channels by altering their trafficking and stabilization suggesting that the variant has a combined effect on cardiac rhythm and neuropsychiatric phenotype.
More...

AA Sequence

MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRYLA      1 - 70
DIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKEGKACVSEVNSFTAAFLFSIETQ     71 - 140
TTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVMAKMAKPKKRNETLVFSHNAVIAMRDGKLCL    141 - 210
MWRVGNLRKSHLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLY    211 - 280
DLSKQDIDNADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEV    281 - 350
PNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP    351 - 420
LRRESEI                                                                   421 - 427
//

Text Mined References (133)

PMID Year Title
26710323 2015 Patients with Dilated Cardiomyopathy and Sustained Monomorphic Ventricular Tachycardia Show Up-Regulation of KCNN3 and KCNJ2 Genes and CACNG8-Linked Left Ventricular Dysfunction.
26663529 2016 Variability in a three-generation family with Pierre Robin sequence, acampomelic campomelic dysplasia, and intellectual disability due to a novel ?1 Mb deletion upstream of SOX9, and including KCNJ2 and KCNJ16.
26390131 2015 Effects of BKCa and Kir2.1 Channels on Cell Cycling Progression and Migration in Human Cardiac c-kit+ Progenitor Cells.
25885757 2015 The clinical and genetic features in a cohort of mainland Chinese patients with thyrotoxic periodic paralysis.
25880778 2015 Upregulation of the inwardly rectifying potassium channel Kir2.1 (KCNJ2) modulates multidrug resistance of small-cell lung cancer under the regulation of miR-7 and the Ras/MAPK pathway.
25727015 2015 Inwardly rectifying Kir2.1 currents in human ?-cells control electrical activity: characterisation and mathematical modelling.
25205296 2014 Structural basis of drugs that increase cardiac inward rectifier Kir2.1 currents.
25205110 2015 The inward rectifier potassium channel Kir2.1 is required for osteoblastogenesis.
25043870 2014 Cell-free identification of novel N-myristoylated proteins from complementary DNA resources using bioorthogonal myristic acid analogues.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
More...