Property Summary

NCBI Gene PubMed Count 204
PubMed Score 408.60
PubTator Score 273.19

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
astrocytoma 1493 3.73151618401441E-27
oligodendroglioma 2849 1.02708513783303E-16
atypical teratoid / rhabdoid tumor 4369 2.87532776186804E-9
sonic hedgehog group medulloblastoma 1482 7.50331701168485E-9
pediatric high grade glioma 2712 4.42303714378824E-7
primitive neuroectodermal tumor 3031 8.50802320290351E-7
medulloblastoma, large-cell 6234 2.81562149146594E-6
cystic fibrosis 1670 1.29995088534095E-4
Multiple myeloma 1328 1.92800536973914E-4
psoriasis 6685 2.80369029574211E-4
Waldenstrons macroglobulinemia 765 6.25494744043371E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.65919904108429E-4
osteosarcoma 7933 0.0010425947193346
ovarian cancer 8492 0.00115136166913509
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00129043054328752
diabetes mellitus 1663 0.00175869882103866
lung cancer 4473 0.00177994964232563
glioblastoma 5572 0.0021700802551452
Disease Target Count Z-score Confidence
Leishmaniasis 49 3.725 1.9
Cancer 2346 3.694 1.8



Accession P63244 B3KTJ0 D3DWS0 P25388 P99049 Q53HU2 Q5J8M6 Q5VLR4 Q6FH47
Symbols H12.3



4UG0   4V6X   5AJ0   5A2Q   5FLX   4AOW  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (138)

26718491 RACK1 interacts with CNTN2, and the effects of RACK1 on glioma cell growth and differentiation are mediated by CNTN2.
26268370 The results suggest a mode of interaction that allows spectrin to attach to the N-terminal/C-terminal part of RACK through the inter-helical AB and BC loops and adopt a multitude of configurations in between the two limiting configurations.
26199092 RACK1 modulated expression of a series of miRNAs, including the miR-302 cluster. It modulated IL8 expression and tumor invasion through miRNA-302c.
26038599 These findings suggest that RACK1 specifies the RANKL-stimulated activation of p38 MAPK by facilitating the association of MKK6 with TAK1
25901709 we found that RACK1 was overexpressed in three human HCC cell lines and in HCC samples. Activation of the IRE1/XBP1 signaling pathway plays a protective role when HCC cells encounter endoplasmic reticulum (ER) stress due to in vitro sorafenib treatment.
25779661 RACK1 pseudosubstrate stimulates leukocytes and may be able to bypass immunosenescence in aging.
25719728 RACK1 predicted poor prognosis in ESCC.
25694432 Data indicate that scaffold protein RACK1 plays a role in IGF-1-mediated protein-tyrosine phosphatase alpha (PTPalpha) tyrosine phosphorylation in MCF-7 Cells.
25686824 We identified five SNPs, especially RACK1 rs3756585T>G, as markers for prognosis of patients with surgically resected non-small cell lung cancer
25650116 we showed that receptor for activated C kinase 1 (RACK1) was expressed in the hippocampus and temporal cortex of the mesial temporal lobe epilepsy human brain

AA Sequence

AEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTIGTR                                     281 - 317

Text Mined References (219)

PMID Year Title
26718491 2016 RACK1 affects glioma cell growth and differentiation through the CNTN2-mediated RTK/Ras/MAPK pathway.
26268370 2015 RACK1 (receptor for activated C-kinase 1) interactions with spectrin repeat elements.
26199092 2015 Loss of RACK1 Promotes Metastasis of Gastric Cancer by Inducing a miR-302c/IL8 Signaling Loop.
26038599 2015 The scaffold protein RACK1 mediates the RANKL-dependent activation of p38 MAPK in osteoclast precursors.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25901709 2015 RACK1 modulates apoptosis induced by sorafenib in HCC cells by interfering with the IRE1/XBP1 axis.
25779661 2015 Immunostimulatory effects of RACK1 pseudosubstrate in human leukocytes obtained from young and old donors.
25719728 2015 RACK1 predicts poor prognosis and regulates progression of esophageal squamous cell carcinoma through its epithelial-mesenchymal transition.
25694432 2015 The interaction of protein-tyrosine phosphatase ? (PTP?) and RACK1 protein enables insulin-like growth factor 1 (IGF-1)-stimulated Abl-dependent and -independent tyrosine phosphorylation of PTP?.
25686824 2015 RACK1 is a candidate gene associated with the prognosis of patients with early stage non-small cell lung cancer.