Property Summary

NCBI Gene PubMed Count 204
Grant Count 122
R01 Count 86
Funding $13,969,692.26
PubMed Score 408.60
PubTator Score 273.19

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P63244 B3KTJ0 D3DWS0 P25388 P99049 Q53HU2 Q5J8M6 Q5VLR4 Q6FH47
Symbols H12.3
HLC-7
PIG21
GNB2L1
Gnb2-rs1

Gene

PDB

4UG0   4V6X   5AJ0   5A2Q   5FLX   4AOW  

Gene RIF (141)

PMID Text
26718491 RACK1 interacts with CNTN2, and the effects of RACK1 on glioma cell growth and differentiation are mediated by CNTN2.
26268370 The results suggest a mode of interaction that allows spectrin to attach to the N-terminal/C-terminal part of RACK through the inter-helical AB and BC loops and adopt a multitude of configurations in between the two limiting configurations.
26199092 RACK1 modulated expression of a series of miRNAs, including the miR-302 cluster. It modulated IL8 expression and tumor invasion through miRNA-302c.
26038599 These findings suggest that RACK1 specifies the RANKL-stimulated activation of p38 MAPK by facilitating the association of MKK6 with TAK1
25901709 we found that RACK1 was overexpressed in three human HCC cell lines and in HCC samples. Activation of the IRE1/XBP1 signaling pathway plays a protective role when HCC cells encounter endoplasmic reticulum (ER) stress due to in vitro sorafenib treatment.
25779661 RACK1 pseudosubstrate stimulates leukocytes and may be able to bypass immunosenescence in aging.
25719728 RACK1 predicted poor prognosis in ESCC.
25694432 Data indicate that scaffold protein RACK1 plays a role in IGF-1-mediated protein-tyrosine phosphatase alpha (PTPalpha) tyrosine phosphorylation in MCF-7 Cells.
25686824 We identified five SNPs, especially RACK1 rs3756585T>G, as markers for prognosis of patients with surgically resected non-small cell lung cancer
25650116 we showed that receptor for activated C kinase 1 (RACK1) was expressed in the hippocampus and temporal cortex of the mesial temporal lobe epilepsy human brain
More...

AA Sequence

MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVV      1 - 70
ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKY     71 - 140
TVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASG    141 - 210
GKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSK    211 - 280
AEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTIGTR                                     281 - 317
//

Text Mined References (219)

PMID Year Title
26718491 2016 RACK1 affects glioma cell growth and differentiation through the CNTN2-mediated RTK/Ras/MAPK pathway.
26268370 2015 RACK1 (receptor for activated C-kinase 1) interactions with spectrin repeat elements.
26199092 2015 Loss of RACK1 Promotes Metastasis of Gastric Cancer by Inducing a miR-302c/IL8 Signaling Loop.
26038599 2015 The scaffold protein RACK1 mediates the RANKL-dependent activation of p38 MAPK in osteoclast precursors.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25901709 2015 RACK1 modulates apoptosis induced by sorafenib in HCC cells by interfering with the IRE1/XBP1 axis.
25779661 2015 Immunostimulatory effects of RACK1 pseudosubstrate in human leukocytes obtained from young and old donors.
25719728 2015 RACK1 predicts poor prognosis and regulates progression of esophageal squamous cell carcinoma through its epithelial-mesenchymal transition.
25694432 2015 The interaction of protein-tyrosine phosphatase ? (PTP?) and RACK1 protein enables insulin-like growth factor 1 (IGF-1)-stimulated Abl-dependent and -independent tyrosine phosphorylation of PTP?.
25686824 2015 RACK1 is a candidate gene associated with the prognosis of patients with early stage non-small cell lung cancer.
More...