Property Summary

NCBI Gene PubMed Count 79
Grant Count 51
R01 Count 21
Funding $5,382,328.34
PubMed Score 144.60
PubTator Score 178.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 0.000

Gene RIF (60)

PMID Text
26773503 Our results suggest that functional, hypusinated eIF5A is necessary for HIF-1alpha expression during hypoxia and that eIF5A is an attractive target for cancer therapy.
26483550 findings also implicate the eIF5A/RhoA/ROCK module as a potential new therapeutic target to treat metastatic PDAC cells
25979826 eIF5A has been shown to regulate a number of gene products specifically, termed the eIF5A regulon, and its role in translating proline-rich sequences has recently been identified.
25874870 HIV-1 Nef downregulates the expression of eukaryotic translation initiation factor 5A (EIF5A) protein in Nef-transfected SupT1 cells
25261239 eIF5A proteins utilize PEAK1 as a downstream effector to drive pancreatic ductal adenocarcinoma (PDAC) pathogenesis.
25218134 Mature eIF5A (hypusinated form) is not involved in the autophagic pathway.
24491565 Data suggest a regulatory mechanism for the pro-apoptotic protein eukaryotic translation initiation factor 5A1 (eIF5A1) in which its level is possibly modulated by NF-kappaB in lung cells.
24402910 The findings that eIF5A and EF-P are important for specific cellular processes and play a role in the relief of ribosome stalling caused by specific amino acid sequences
24220243 mature eIF5A controls a translational network of cancer-driving genes, termed the eIF5A regulon, at the levels of mRNA abundance and translation
23991020 Data indicate that the signal of EIF5A2, MYCN, and MCL1 genes is decreased in hydroxyurea (HU) and gemcitabine (GEM) treated UACC-1598 ovarian cancer cell line.
More...

AA Sequence

MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYE      1 - 70
DICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSA     71 - 140
MTEEAAVAIKAMAK                                                            141 - 154
//

Text Mined References (87)

PMID Year Title
26773503 2016 Eukaryotic translation initiation factor 5A (eIF5A) is essential for HIF-1? activation in hypoxia.
26483550 2015 Eukaryotic Translation Initiation Factor 5A (EIF5A) Regulates Pancreatic Cancer Metastasis by Modulating RhoA and Rho-associated Kinase (ROCK) Protein Expression Levels.
25979826 2015 The translation factor eIF5A and human cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25261239 2014 A hypusine-eIF5A-PEAK1 switch regulates the pathogenesis of pancreatic cancer.
25218134 2014 The spermidine analogue GC7 (N1-guanyl-1,7-diamineoheptane) induces autophagy through a mechanism not involving the hypusination of eIF5A.
24491565 2014 Cadmium induces cytotoxicity in human bronchial epithelial cells through upregulation of eIF5A1 and NF-kappaB.
24402910 eIF5A and EF-P: two unique translation factors are now traveling the same road.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...