Property Summary

NCBI Gene PubMed Count 24
Grant Count 2
Funding $80,319.5
PubMed Score 3.96
PubTator Score 4.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Prostatic Neoplasms 471
lung carcinoma 2,844

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.600 0.000

Synonym

Accession P63218 B2R5A0 P30670 Q5VX54 Q61015
Symbols

Gene

 Grant Application (2)

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL        1 - 68
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
More...