Property Summary

NCBI Gene PubMed Count 25
PubMed Score 4.05
PubTator Score 4.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count P-value
lung carcinoma 2843 2.1e-28

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.600 2.1e-28

Gene RIF (2)

AA Sequence

MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL        1 - 68
//

Text Mined References (32)

PMID Year Title