Property Summary

NCBI Gene PubMed Count 19
Grant Count 1
Funding $65,414.33
PubMed Score 4.53
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession P63215 B2R4S7 P29798 Q61014
Symbols

Gene

 Grant Application (1)

Gene RIF (3)

PMID Text
23326349 Findings suggest a wide-ranging mechanism by which direct interaction of Gbetagamma with specific chromatin bound transcription factors regulates functional gene networks in response to GPCR activation in cells including the angiotensin II type 1 receptor.
22082156 Knockdown of guanine nucleotide binding protein (G protein), gamma 3 (GNG3) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20534534 Golgi structure and secretion is regulated by receptor-induced G protein betagamma complex translocation

AA Sequence

MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKF      1 - 70
FCALL                                                                      71 - 75
//

Text Mined References (20)

PMID Year Title
26900580 2016 Pathogenic mechanism of recurrent mutations of SCN8A in epileptic encephalopathy.
23326349 2013 Interaction of G-protein ?? complex with chromatin modulates GPCR-dependent gene regulation.
20534534 2010 Regulation of Golgi structure and secretion by receptor-induced G protein ?? complex translocation.
17185339 2007 Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15314181 2004 Mice with deficiency of G protein gamma3 are lean and have seizures.
15078334 2004 Characterization of heterotrimeric G protein complexes in rice plasma membrane.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12626323 2003 Glucagon and regulation of glucose metabolism.
More...