Property Summary

NCBI Gene PubMed Count 19
PubMed Score 4.53
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -3.400 6.9e-07
astrocytic glioma -3.300 2.4e-03
Astrocytoma, Pilocytic -1.500 4.0e-06
atypical teratoid / rhabdoid tumor -3.500 2.9e-06
ependymoma -4.000 1.3e-03
glioblastoma -3.300 4.2e-09
group 3 medulloblastoma -4.600 2.8e-08
medulloblastoma, large-cell -4.100 1.0e-07
oligodendroglioma -2.700 1.0e-02
Pick disease -1.500 9.9e-03
primitive neuroectodermal tumor -1.500 3.2e-02
subependymal giant cell astrocytoma -2.853 2.0e-02

Protein-protein Interaction (12)

Gene RIF (3)

AA Sequence

MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKF      1 - 70
FCALL                                                                      71 - 75
//

Text Mined References (20)

PMID Year Title