Property Summary

NCBI Gene PubMed Count 122
Grant Count 183
R01 Count 120
Funding $16,185,845.76
PubMed Score 305.79
PubTator Score 184.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession P63208 D3DQ97 D3DQ98 P34991 Q8TAY2
Symbols OCP2
p19A
EMC19
SKP1A
OCP-II
TCEB1L

Gene

PDB

4I6J   3L2O   1LDK   5IBK   1FQV   1FS1   1FS2   1P22   2ASS   2AST   2E31   2E32   2OVP   2OVQ   2OVR   3WSO  

Gene RIF (30)

PMID Text
26573739 Both the F-box domain of Skp2 and Skp1-Skp2 domain motions displaying preferential conformational control can together facilitate polyubiquitination of a wide variety of substrates.
26474281 Skp1 is critical to lung cancer pathogenesis
25460509 Data show that epithelial-mesenchymal transition (EMT)-transcription factors can be dynamically degraded by an atypical ubiquitin E3 ligase complex Skp1-Pam-Fbxo45 (SPFFbxo45).
25425648 We discuss how these results can explain the rapid association of Cdc34 and Skp1-cullin-F-box ligase (SCF).
24085301 Substrate binding promotes formation of the Skp1-Cul1-Fbxl3 (SCF(Fbxl3)) protein complex.
23988235 SKP1 variation modifies association between Parkinson's disease and ubiquitin-proteasome system-inhibiting pesticides
23624913 Studies indicate that in SCFs, Rbx1 serves as the RING-containing enzyme, Cul1 is the Cullin scaffold, and Skp1 is an adaptor, which serves to link the beta-TrCP F-box substrate-specific factor to the rest of the ligase.
23027877 Skp1-Cul1-F-box ubiquitin ligase (SCF(betaTrCP))-mediated destruction of the ubiquitin-specific protease USP37 during G2-phase promotes mitotic entry
22767593 Deconjugation of Nedd8 from Cul1 is directly regulated by Skp1-F-box and substrate, and the COP9 signalosome inhibits deneddylated SCF by a noncatalytic mechanism.
22761574 we determined that the phage-encoded GogB effector protein in Salmonella targets the host SCF E3 type ubiquitin ligase through an interaction with Skp1 and the human F-box only 22 (FBXO22) protein
More...

AA Sequence

MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPP      1 - 70
PPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFN     71 - 140
IKNDFTEEEEAQVRKENQWCEEK                                                   141 - 163
//

Text Mined References (135)

PMID Year Title
26790640 2016 F-box protein FBXL2 inhibits gastric cancer proliferation by ubiquitin-mediated degradation of forkhead box M1.
26573739 2016 Molecular dynamics simulations elucidate the mode of protein recognition by Skp1 and the F-box domain in the SCF complex.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26474281 2015 Skp1 in lung cancer: clinical significance and therapeutic efficacy of its small molecule inhibitors.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25704143 Cep68 can be regulated by Nek2 and SCF complex.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25585578 2015 FBH1 influences DNA replication fork stability and homologous recombination through ubiquitylation of RAD51.
25503564 2015 Degradation of Cep68 and PCNT cleavage mediate Cep215 removal from the PCM to allow centriole separation, disengagement and licensing.
25460509 2015 Atypical ubiquitin E3 ligase complex Skp1-Pam-Fbxo45 controls the core epithelial-to-mesenchymal transition-inducing transcription factors.
More...