Property Summary

NCBI Gene PubMed Count 37
Grant Count 56
R01 Count 44
Funding $7,505,153.65
PubMed Score 210.32
PubTator Score 140.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Multiple myeloma 1.000 0.033
ependymoma 2.000 0.039
cutaneous lupus erythematosus 1.100 0.003
psoriasis 1.300 0.000
astrocytoma 1.800 0.000
glioblastoma 2.000 0.000
oligodendroglioma 1.700 0.000
osteosarcoma 1.133 0.000
group 3 medulloblastoma 2.200 0.000
atypical teratoid/rhabdoid tumor 1.900 0.000
primitive neuroectodermal tumor 1.700 0.000
juvenile dermatomyositis 1.014 0.000
primary pancreatic ductal adenocarcinoma 1.093 0.002
diabetes mellitus -1.500 0.002
pediatric high grade glioma 1.400 0.000
pilocytic astrocytoma 1.200 0.000
subependymal giant cell astrocytoma 1.784 0.027
ductal carcinoma in situ 1.100 0.002
ovarian cancer -1.700 0.000
pancreatic cancer 1.100 0.003
dermatomyositis 1.100 0.003

Gene RIF (19)

PMID Text
26792716 The results implicate MTs/DYNLT1 as drivers of Vpr nuclear import and HIV infection, with important therapeutic implications.
26432663 Study reports a defect in the expression of DYNLT1 in the germ cells of infertile human males and implicates DYNLT1 in spermatogonial cell division and differentiation.
26227614 Data suggest that both microtubule-associated DYNLT (dynein light chain Tctex-type 1) and cytoplasmic DYNLT (dynein 1 intermediate chain 2 DYNC1LI2) are equally able to bind to small GTPases Rab3D (Rab3d GTPase) and RagA (Ras-related GTP binding A).
25944661 DYNLT1 is enriched at focal concentrations of CT850 on the chlamydial inclusion membrane that are known to interact with dynein and microtubules.
25928583 Reveal a dynein independent role of Tctex-1 at the kinetochore to enhance the stability of kinetochore-microtubule attachment.
24170091 Data suggest that DYNLT1 phosphorylation at serine S82 is involved in microtubule and mitochondria regulation, and their interaction and cooperation contribute to the cellular hypoxic tolerance.
22164227 there are two possible mechanisms triggered by MAP4: stabilization of MT networks; DYNLT1 modulation, which is connected with VDAC1, and inhibition of hypoxia-induced mitochondrial permeabilization
22028875 Dynlt1 modulates orexin signaling by regulating OX1R
21835165 A link between REIC/Dkk- 3 and Tctex-1 may therefore be of significance for understanding the molecular functions of the proteins in ER stress signaling and the intracellular dynein motor dynamics, respectively.
21767858 These data show that Tctex-1 may play a role in late stages of viral replication through its interaction with the flavivirus membrane protein.
More...

AA Sequence

MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIM      1 - 70
QKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI                                71 - 113
//

Text Mined References (44)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26792716 2016 Fast track, dynein-dependent nuclear targeting of human immunodeficiency virus Vpr protein; impaired trafficking in a clinical isolate.
26432663 2015 Aberrant Expression of Dynein light chain 1 (DYNLT1) is Associated with Human Male Factor Infertility.
26227614 2015 DYNLT (Tctex-1) forms a tripartite complex with dynein intermediate chain and RagA, hence linking this small GTPase to the dynein motor.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25944661 2015 Chlamydia trachomatis inclusion membrane protein CT850 interacts with the dynein light chain DYNLT1 (Tctex1).
25928583 2015 A dynein independent role of Tctex-1 at the kinetochore.
24170091 2013 Phosphorylation of DYNLT1 at serine 82 regulates microtubule stability and mitochondrial permeabilization in hypoxia.
23954591 2013 IGF-1 activates a cilium-localized noncanonical G?? signaling pathway that regulates cell-cycle progression.
23840580 2013 Dynein Light Chain 1 (DYNLT1) Interacts with Normal and Oncogenic Nucleoporins.
More...