Property Summary

NCBI Gene PubMed Count 37
PubMed Score 210.32
PubTator Score 140.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
astrocytoma 1493 1.44995683903591E-32
oligodendroglioma 2849 9.55782602191594E-17
juvenile dermatomyositis 1189 1.47656498689897E-10
atypical teratoid/rhabdoid tumor 1095 5.8242106839848E-10
pilocytic astrocytoma 3086 3.13193122640405E-6
ovarian cancer 8492 3.45293527850975E-6
pediatric high grade glioma 2712 4.71648474645133E-6
osteosarcoma 7933 1.43612162679855E-5
group 3 medulloblastoma 2254 2.3445515204608E-5
primitive neuroectodermal tumor 3031 3.2011011291941E-5
glioblastoma 5572 1.36530383122765E-4
psoriasis 6685 1.56466924514762E-4
diabetes mellitus 1663 0.00156157326959772
ductal carcinoma in situ 1745 0.00159555774128576
primary pancreatic ductal adenocarcinoma 1271 0.00213861191802796
dermatomyositis 967 0.00286801695404281
pancreatic cancer 2300 0.00298838087503535
cutaneous lupus erythematosus 1056 0.00336445076227688
subependymal giant cell astrocytoma 2287 0.0266575959557924
Multiple myeloma 1328 0.0334871739075666
ependymoma 2514 0.0388757729085484
Disease Target Count Z-score Confidence
Vasculitis 64 3.234 1.6
Spondylitis 4 3.102 1.6

Expression

  Differential Expression (21)

Disease log2 FC p
Multiple myeloma 1.000 0.033
ependymoma 2.000 0.039
cutaneous lupus erythematosus 1.100 0.003
psoriasis 1.300 0.000
astrocytoma 1.800 0.000
glioblastoma 2.000 0.000
oligodendroglioma 1.700 0.000
osteosarcoma 1.133 0.000
group 3 medulloblastoma 2.200 0.000
atypical teratoid/rhabdoid tumor 1.900 0.000
primitive neuroectodermal tumor 1.700 0.000
juvenile dermatomyositis 1.014 0.000
primary pancreatic ductal adenocarcinoma 1.093 0.002
diabetes mellitus -1.500 0.002
pediatric high grade glioma 1.400 0.000
pilocytic astrocytoma 1.200 0.000
subependymal giant cell astrocytoma 1.784 0.027
ductal carcinoma in situ 1.100 0.002
ovarian cancer -1.700 0.000
pancreatic cancer 1.100 0.003
dermatomyositis 1.100 0.003

Synonym

Accession P63172 Q15763 Q5VTU4
Symbols CW-1
TCTEL1
tctex-1

Gene

PDB

5JPW  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA Inparanoid
Mouse OMA EggNOG
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Zebrafish OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (19)

PMID Text
26792716 The results implicate MTs/DYNLT1 as drivers of Vpr nuclear import and HIV infection, with important therapeutic implications.
26432663 Study reports a defect in the expression of DYNLT1 in the germ cells of infertile human males and implicates DYNLT1 in spermatogonial cell division and differentiation.
26227614 Data suggest that both microtubule-associated DYNLT (dynein light chain Tctex-type 1) and cytoplasmic DYNLT (dynein 1 intermediate chain 2 DYNC1LI2) are equally able to bind to small GTPases Rab3D (Rab3d GTPase) and RagA (Ras-related GTP binding A).
25944661 DYNLT1 is enriched at focal concentrations of CT850 on the chlamydial inclusion membrane that are known to interact with dynein and microtubules.
25928583 Reveal a dynein independent role of Tctex-1 at the kinetochore to enhance the stability of kinetochore-microtubule attachment.
24170091 Data suggest that DYNLT1 phosphorylation at serine S82 is involved in microtubule and mitochondria regulation, and their interaction and cooperation contribute to the cellular hypoxic tolerance.
22164227 there are two possible mechanisms triggered by MAP4: stabilization of MT networks; DYNLT1 modulation, which is connected with VDAC1, and inhibition of hypoxia-induced mitochondrial permeabilization
22028875 Dynlt1 modulates orexin signaling by regulating OX1R
21835165 A link between REIC/Dkk- 3 and Tctex-1 may therefore be of significance for understanding the molecular functions of the proteins in ER stress signaling and the intracellular dynein motor dynamics, respectively.
21767858 These data show that Tctex-1 may play a role in late stages of viral replication through its interaction with the flavivirus membrane protein.
More...

AA Sequence

MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIM      1 - 70
QKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI                                71 - 113
//

Text Mined References (44)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26792716 2016 Fast track, dynein-dependent nuclear targeting of human immunodeficiency virus Vpr protein; impaired trafficking in a clinical isolate.
26432663 2015 Aberrant Expression of Dynein light chain 1 (DYNLT1) is Associated with Human Male Factor Infertility.
26227614 2015 DYNLT (Tctex-1) forms a tripartite complex with dynein intermediate chain and RagA, hence linking this small GTPase to the dynein motor.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25944661 2015 Chlamydia trachomatis inclusion membrane protein CT850 interacts with the dynein light chain DYNLT1 (Tctex1).
25928583 2015 A dynein independent role of Tctex-1 at the kinetochore.
24170091 2013 Phosphorylation of DYNLT1 at serine 82 regulates microtubule stability and mitochondrial permeabilization in hypoxia.
23954591 2013 IGF-1 activates a cilium-localized noncanonical G?? signaling pathway that regulates cell-cycle progression.
23840580 2013 Dynein Light Chain 1 (DYNLT1) Interacts with Normal and Oncogenic Nucleoporins.
More...