Property Summary

NCBI Gene PubMed Count 39
PubMed Score 213.23
PubTator Score 140.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.400 6.7e-04
astrocytoma 1.800 1.4e-32
Astrocytoma, Pilocytic 1.300 1.5e-06
atypical teratoid / rhabdoid tumor 1.700 3.4e-09
cutaneous lupus erythematosus 1.100 3.4e-03
dermatomyositis 1.100 2.9e-03
diabetes mellitus -1.500 1.6e-03
ductal carcinoma in situ 1.100 1.6e-03
ependymoma 2.000 3.9e-02
glioblastoma 1.400 2.9e-08
group 3 medulloblastoma 2.200 2.3e-05
juvenile dermatomyositis 1.014 1.5e-10
Multiple myeloma 1.000 3.3e-02
oligodendroglioma 1.700 9.6e-17
osteosarcoma 1.133 1.4e-05
ovarian cancer -1.700 3.5e-06
pancreatic cancer 1.100 3.0e-03
primary pancreatic ductal adenocarcinoma 1.093 2.1e-03
primitive neuroectodermal tumor 1.700 3.2e-05
psoriasis 1.300 1.6e-04
subependymal giant cell astrocytoma 1.784 2.7e-02

Gene RIF (22)

AA Sequence

MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIM      1 - 70
QKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI                                71 - 113
//

Text Mined References (46)

PMID Year Title