Property Summary

NCBI Gene PubMed Count 96
PubMed Score 581.33
PubTator Score 702.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia -1.300 5.0e-02
acute quadriplegic myopathy 1.616 1.2e-05
autosomal dominant Emery-Dreifuss muscul... 1.049 1.2e-02
Becker muscular dystrophy 1.107 5.1e-03
Breast cancer 2.800 2.7e-02
Duchenne muscular dystrophy 1.315 6.5e-07
hepatocellular carcinoma 1.200 1.1e-05
juvenile dermatomyositis 1.318 3.8e-09
lung cancer 1.100 7.3e-03
Multiple myeloma 1.161 2.5e-02
ovarian cancer -1.300 1.1e-05
tuberculosis and treatment for 6 months -1.600 3.2e-03
Waldenstrons macroglobulinemia 1.373 1.7e-03

Protein-protein Interaction (1)

Gene RIF (43)

AA Sequence

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHET      1 - 70
KHFIYFYLGQVAILLFKSG                                                        71 - 89
//

Text Mined References (103)

PMID Year Title