Property Summary

NCBI Gene PubMed Count 90
Grant Count 5
Funding $278,685
PubMed Score 525.61
PubTator Score 702.51

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P63167 Q15701
Symbols LC8
PIN
DLC1
DLC8
LC8a
DNCL1
hdlc1
DNCLC1

Gene

PDB

1CMI   3ZKE   3ZKF  

 GO Function (1)

Gene RIF (48)

PMID Text
26923072 DLC1 binding to nNOS-calmodulin complex does not affect the electron transport from the reductase to the oxygenase domain.
26652654 NMR-derived secondary chemical shifts and relaxation properties show that the Chica LC8 binding domain is essentially disordered with a dynamically restricted segment in one linker between motifs.
26226419 Studies indicate that dynein light chain LC8 has been termed an intrinsically disordered proteins (IDPs) dimerization 'hub' protein.
26157129 DLC1 binding motif in L is involved in cytoskeleton localization and reorganization, primary transcription regulation by DLC1, and regulation of cellular DLC1 gene expression.
25741013 Authors demonstrate that the interaction between ebola virus VP35 and dynein LC8 is direct and of high affinity and that binding stabilizes the VP35 N-terminal oligomerization domain and enhances viral RNA synthesis.
25568209 Overall, this study demonstrates the novel interaction between HIV-1 integrase and cellular DYNLL1 proteins and suggests the requirement of this virus-cell interaction for proper uncoating and efficient reverse transcription of HIV-1.
25568209 Knockdown of DYNLL1 by shRNA leads to reduced levels of particulate CA in HIV-1-infected cells, suggesting that DYNLL1 plays an important role in CA uncoating
25568209 Knockdown of DYNLL1 by shRNA leads to reduced levels of particulate CA in HIV-1-infected cells, suggesting that DYNLL1 plays an important role in CA uncoating
25568209 Knockdown of DYNLL1 by shRNA leads to reduced levels of particulate CA in HIV-1-infected cells, suggesting that DYNLL1 plays an important role in CA uncoating
25568209 Knockdown of DYNLL1 by shRNA leads to reduced levels of particulate CA in HIV-1-infected cells, suggesting that DYNLL1 plays an important role in CA uncoating
More...

AA Sequence

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHET      1 - 70
KHFIYFYLGQVAILLFKSG                                                        71 - 89
//

Text Mined References (96)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26923072 2016 The protein inhibitor of nNOS (PIN/DLC1/LC8) binding does not inhibit the NADPH-dependent heme reduction in nNOS, a key step in NO synthesis.
26652654 2016 The Anchored Flexibility Model in LC8 Motif Recognition: Insights from the Chica Complex.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26226419 2015 Multivalent IDP assemblies: Unique properties of LC8-associated, IDP duplex scaffolds.
26157129 2015 A Dynein Light Chain 1 Binding Motif in Rabies Virus Polymerase L Protein Plays a Role in Microtubule Reorganization and Viral Primary Transcription.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25741013 2015 Ebola virus VP35 interaction with dynein LC8 regulates viral RNA synthesis.
25568209 2015 Human immunodeficiency virus type 1 employs the cellular dynein light chain 1 protein for reverse transcription through interaction with its integrase protein.
25416956 2014 A proteome-scale map of the human interactome network.
More...