Property Summary

NCBI Gene PubMed Count 338
Grant Count 287
R01 Count 216
Funding $26,309,509.18
PubMed Score 474.21
PubTator Score 466.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 0.002

Synonym

Accession P63165 A8MUS8 B2R4I5 P55856 Q6FGG0 Q6NZ62 Q93068 SUMO-1
Symbols DAP1
GMP1
PIC1
SMT3
UBL1
OFC10
SENP2
SMT3C
SMT3H3

Gene

PDB

4WJN   4WJO   1WYW   1TGZ   2IO2   5AEK   1Z5S   2PE6   3UIP   1A5R   1Y8R   2ASQ   2BF8   2G4D   2IY0   2IY1   2KQS   2LAS   2MW5   2N1A   2N1V   2UYZ   2VRR   3KYC   3KYD   3RZW   4WJP   4WJQ  

Gene RIF (206)

PMID Text
26578773 PML IV/ARF interaction enhances p53 SUMO-1 conjugation, activation, and senescence.
26563097 Roles for SUMO in pre-mRNA processing
26549688 SUMOylation at specific sites on PXR protein are involved in enhancement of transcription function of this receptor.
26449956 Knockdown of SUMO1 using specific siRNA influenced the accumulation of lipid droplets and reduced HCV replication.
26403314 Data identify PDGFRbeta as the hub gene in both inflammatory (IBC) and non-inflammatory breast neoplasm (non-IBC) and SUMO1 and COL1A1 the respective key genes for IBC and non-IBC suggesting they might play important role in the pathogenesis of the neoplasm.
26400283 High DAP1 expression is associated with a 4-fold increase in the risk of lymph node metastases in squamous cell carcinoma of the oral cavity.
26244656 SUMO-1 modification may affect the transcriptional activity of EGFR
26223657 Data indicate that small ubiquitin-like modifiers SUMO1, SUMO2, or SUMO3 were found in nuclear speckles.
26212320 The LKB1 K178R SUMO mutant had defective AMPK signaling and mitochondrial function, inducing death in energy-deprived cells.
26060329 Data suggest that small ubiquitin-related modifier protein SUMO1 modification of the promyelocytic leukemia protein (PML) RING domain promotes SUMO2 conjugation to Lys160.
More...

AA Sequence

MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQR      1 - 70
IADNHTPKELGMEEEDVIEVYQEQTGGHSTV                                            71 - 101
//

Text Mined References (355)

PMID Year Title
26578773 2015 PML IV/ARF interaction enhances p53 SUMO-1 conjugation, activation, and senescence.
26563097 Roles for SUMO in pre-mRNA processing.
26549688 2016 Transcription regulation of nuclear receptor PXR: Role of SUMO-1 modification and NDSM in receptor function.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26449956 2016 SUMO1 depletion prevents lipid droplet accumulation and HCV replication.
26403314 2016 Systematically identify key genes in inflammatory and non-inflammatory breast cancer.
26400283 2015 DAP1 high expression increases risk of lymph node metastases in squamous cell carcinoma of the oral cavity.
26244656 2015 The Nucleus-Localized Epidermal Growth Factor Receptor Is SUMOylated.
26223657 2015 Small Ubiquitin-like Modifier Alters IFN Response.
26212320 2015 A Critical SUMO1 Modification of LKB1 Regulates AMPK Activity during Energy Stress.
More...