Property Summary

NCBI Gene PubMed Count 370
PubMed Score 482.69
PubTator Score 466.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 1.6e-03

 OMIM Phenotype (1)

PDB (31)

Gene RIF (218)

AA Sequence

MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQR      1 - 70
IADNHTPKELGMEEEDVIEVYQEQTGGHSTV                                            71 - 101
//

Text Mined References (387)

PMID Year Title