Property Summary

NCBI Gene PubMed Count 23
PubMed Score 45.00
PubTator Score 7.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.400 4.6e-08
atypical teratoid / rhabdoid tumor -1.200 1.7e-05
ependymoma -1.400 3.8e-02
glioblastoma -1.300 8.5e-09
intraductal papillary-mucinous carcinoma... -1.700 3.2e-03
intraductal papillary-mucinous neoplasm ... -2.800 9.1e-03
lung cancer 1.200 1.9e-04
malignant mesothelioma -6.300 5.7e-09
medulloblastoma, large-cell -1.500 5.9e-06
Multiple myeloma 1.153 8.7e-03
ovarian cancer -2.100 9.2e-05
sonic hedgehog group medulloblastoma -1.100 4.9e-08
subependymal giant cell astrocytoma -1.581 5.3e-03

 GO Function (1)

Gene RIF (5)

AA Sequence

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLV      1 - 70
LLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGVGRAAGRGVPAGVPIPQAPAGLAGPVRGVGGPSQQ     71 - 140
VMTPQGRGTVAAAAVAATASIAGAPTQYPPGRGTPPPPVGRATPPPGIMAPPPGMRPPMGPPIGLPPARG    141 - 210
TPIGMPPPGMRPPPPGIRGPPPPGMRPPRP                                            211 - 240
//

Text Mined References (27)

PMID Year Title