Property Summary

NCBI Gene PubMed Count 59
Grant Count 1
R01 Count 1
Funding $88,101.25
PubMed Score 14.55
PubTator Score 25.35

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P63151 B2RBU8 B4E1T7 P50409 Q00007
Symbols B55A
PR52A
PR55A
B55ALPHA

Gene

 Grant Application (1)

PDB

3DW8  

 GWAS Trait (1)

Gene RIF (52)

PMID Text
26310906 Concurrent mTORC1 inactivation and PP2A-B55alpha stimulation fuel ULK1-dependent autophagy.
26297546 miR-556-5p functions as an onco-miRNA and participates in prostate cancer carcinogenesis by suppressing PPP2R2A expression.
26054685 overexpression of miR-892a may provide a selective growth promotion for colorectal cancer cells by direct suppression of PPP2R2A expression.
25879784 Data show that breast cancer (BC) with PPP2R2A deletions are associated with worse overall survival, and the combination of altered PPP2R2A and high CCND1 expression define a subgroup of luminal-like BC patients with a high risk of relapse and death.
25654102 miR-136 may play an important role during TGF-beta1-induced proliferation arrest by targeting PPP2R2A in keratinocytes.
25238119 Data suggest livers of biliary atresia subjects exhibit overexpression of MIR222 (microRNA 222); this appears to contribute to liver fibrosis (and in vitro cell proliferation) by targeting PPP2R2A (protein phosphatase 2A subunit B) and Akt signaling.
24858343 The suppression of B55alpha activates signaling pathways that could support leukemia cell survival.
24244166 Identification of the adenovirus E4orf4 protein binding site on the B55alpha and Cdc55 regulatory subunits of PP2A: Implications for PP2A
23959478 miR-136 promotes Erk1/2 phosphorylation through targeting PPP2R2A in NSCLC cells and suggest that it may serve as a therapeutic target in NSCLC therapy.
23287597 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
More...

AA Sequence

MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSHSRGE      1 - 70
YNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEED     71 - 140
GRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDR    141 - 210
SFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSF    211 - 280
FSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCW    281 - 350
NGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL    351 - 420
HTAWHPKENIIAVATTNNLYIFQDKVN                                               421 - 447
//

Text Mined References (64)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26310906 2015 Regulation of autophagy by coordinated action of mTORC1 and protein phosphatase 2A.
26297546 2015 Upregulation of miR-556-5p promoted prostate cancer cell proliferation by suppressing PPP2R2A expression.
26054685 2015 miR-892a regulated PPP2R2A expression and promoted cell proliferation of human colorectal cancer cells.
25879784 2015 Altered PPP2R2A and Cyclin D1 expression defines a subgroup of aggressive luminal-like breast cancer.
25654102 2015 miR-136 modulates TGF-?1-induced proliferation arrest by targeting PPP2R2A in keratinocytes.
25238119 2015 miR-222 overexpression may contribute to liver fibrosis in biliary atresia by targeting PPP2R2A.
24858343 2014 The protein phosphatase 2A regulatory subunit B55? is a modulator of signaling and microRNA expression in acute myeloid leukemia cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...