Property Summary

NCBI Gene PubMed Count 49
PubMed Score 38.88
PubTator Score 325.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.100 4.5e-03
astrocytic glioma -1.400 2.5e-02
atypical teratoid / rhabdoid tumor -1.800 5.9e-08
ependymoma -1.200 1.2e-08
glioblastoma -1.300 6.0e-04
limb girdle muscular dystrophy 2A -1.008 5.6e-06
lung adenocarcinoma -1.100 2.9e-07
lung cancer -1.100 6.5e-03
medulloblastoma, large-cell -1.500 9.6e-05
Multiple myeloma 1.262 2.8e-03
oligodendroglioma -1.400 3.3e-02
ovarian cancer -1.300 1.4e-07
primitive neuroectodermal tumor -1.100 5.2e-04
psoriasis 1.200 2.9e-04
spina bifida -1.004 4.6e-02
tuberculosis and treatment for 3 months -1.100 2.0e-06

Protein-protein Interaction (3)

Gene RIF (29)

AA Sequence

MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTV      1 - 70
RFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKR     71 - 140
VSAIVEQSWNDS                                                              141 - 152
//

Text Mined References (54)

PMID Year Title