Property Summary

NCBI Gene PubMed Count 41
Grant Count 10
R01 Count 5
Funding $356,452.62
PubMed Score 38.76
PubTator Score 325.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.262 0.003
astrocytic glioma -1.700 0.015
oligodendroglioma -1.400 0.033
psoriasis 1.200 0.000
ependymoma -1.200 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.100 0.001
limb girdle muscular dystrophy 2B -1.156 0.000
tuberculosis and treatment for 3 months -1.100 0.000
lung cancer -1.900 0.000
adult high grade glioma -1.300 0.003
lung adenocarcinoma -1.100 0.000
spina bifida -1.004 0.046
ovarian cancer -2.300 0.000

Gene RIF (24)

PMID Text
26679603 These findings show the importance of Rad6 in ovarian cancer and emphasize the need for further studies of Rad6 as a potential target for the treatment of ovarian cancer.
26336826 Data show that the ubiquitin-conjugating enzyme E2 RAD6A/B-MDM2 ubiquitin ligase machinery regulates anti-silencing function 1A protein (ASF1A) degradation.
26223869 A novel variant (Chr5.133706925 A > G) residing in the UBE2B gene promoter region confers a high risk for idiopathic azoospermia in a Chinese population.
25384975 RAD6 physically interacts with heterochromatin protein 1alpha and ubiquitinates HP1alpha at residue K154, thereby promoting heterochromatin protein 1alpha degradation through the autophagy pathway
23525009 RNF168, in complex with RAD6A or RAD6B, is activated in the DNA-damage-induced protein ubiquitination cascade.
23378580 UBE2B mRNA alterations are associated with severe oligozoospermia in infertile men.
23079972 UBE2B polymorphisms g.-293T>G, g.20016A>G and g.9157A>G are not associated with male infertility, and the GA haplotype is likely a protective factor for male fertility in Northeast Chinese men.
22705350 beta-catenin and Rad6B interacting regions, were identified.
22547805 The Rad6-Rad18 enzyme plays an essential role in promoting replication through DNA lesions by translesion synthesis in mammalian cells.
22083959 RAD6 can form a ternary complex with MDM2 and p53 that contributes to the degradation of p53.
More...

AA Sequence

MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTV      1 - 70
RFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKR     71 - 140
VSAIVEQSWNDS                                                              141 - 152
//

Text Mined References (46)

PMID Year Title
26679603 2016 Rad6 upregulation promotes stem cell-like characteristics and platinum resistance in ovarian cancer.
26336826 2015 A conserved RAD6-MDM2 ubiquitin ligase machinery targets histone chaperone ASF1A in tumorigenesis.
26223869 2015 A functional variant in the UBE2B gene promoter is associated with idiopathic azoospermia.
25384975 2015 RAD6 promotes homologous recombination repair by activating the autophagy-mediated degradation of heterochromatin protein HP1.
23525009 2013 RNF168 forms a functional complex with RAD6 during the DNA damage response.
23378580 2013 UBE2B mRNA alterations are associated with severe oligozoospermia in infertile men.
23079972 2012 Genetic association of UBE2B variants with susceptibility to male infertility in a Northeast Chinese population.
22705350 2012 Lysine 394 is a novel Rad6B-induced ubiquitination site on beta-catenin.
22547805 2012 Requirement of Rad18 protein for replication through DNA lesions in mouse and human cells.
22083959 2012 RAD6 regulates the dosage of p53 by a combination of transcriptional and posttranscriptional mechanisms.
More...