Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

NKSKKRRNRVSFLGAATVEPPKPIPLTWKTEKPVWVNQWPLPKQKLEALHLLANEQLEKGHIEPSFSPWN      1 - 70
SPVFVIQKKSGKWRMLTDLRAVNAVIQPMGPLQPGLPSPAMIPKDWPLIIIDLKDCFFTIPLAEQDCEKF     71 - 140
AFTIPAINNKEPATRFQWKVLPQGMLNSPTICQTFVGRALQPVREKFSDCYIIHYIDDILCAAETKDKLI    141 - 210
DCYTFLQAEVANAGLAIASDKIQTSTPFHYLGMQIENRKIKPQKIEIRKDTLKALNDFQKLLGDINWIRP    211 - 280
TLGIPTYAMSNLFSILRGDSDLNSKRMLTPEATKEIKLVEEKIQSAQINRIDPLAPLQLLIFATAHSPTG    281 - 350
IIIQNTDLVEWSFLPHSTVKTFTLYLDQIATLIGQTRLRIIKLCGNDPDKIVVPLTKEQVRQAFINSGAW    351 - 420
QIGLANFVGIIDNHYPKTKIFQFLKLTTWILPKITRREPLENALTVFTDGSSNGKAAYTGPKERVIKTPY    421 - 490
QSAQRAELVAVITVLQDFDINIISDSAYVVQATRDVETALIKYSMDDQLNQLFNLLQQTVRKRNFPFYIT    491 - 560
HIRAHTNLPGPLTKANKQADLLVSSALIKAQELHALTHVNAAGLKNKFDVTWKLAKDIVQHCTQCQVLHL    561 - 630
PTQEAGVNPRGLCPNALWQMDVTHVPSFGRLSYVHVTVDTYSHFIWATCHTGESTSHVKKHLLSCFAVMG    631 - 700
VPEKIKTDNGPGYCSKAFQKFLSQWKISHTTGIPYNSQGQAIVERTNRTLKTQLVKQKEGGDSKECTTPQ    701 - 770
MQLNLALYTLNFLNIYRNQTTTSAEQHLTGKKNSPHEGKLIWWKDNKNKTWEIGKVITWGRGFACVSPGE    771 - 840
NQLPVWIPTRHLKFYNEPIRDAKKSTSAETETPQSSTVDSQDEQNGDVRRTDEVAIHQEGRAANLGTTKE    841 - 910
ADAVSYKISREHKGDTNPREYAACSLDDCINGGKSPYACRSSCS                              911 - 954
//

Text Mined References (4)

PMID Year Title
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
18664271 2008 Expression patterns of transcribed human endogenous retrovirus HERV-K(HML-2) loci in human tissues and the need for a HERV Transcriptome Project.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.