Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

NKSKKRRNRVSFLGVATIEPPKPIPLTWKTEKLVWVNQWPLPKQKLEALHLLANEQLEKGHIEPSFSPWN      1 - 70
SPVFVIQKKSGKWRMLTDLRAVNAVIQPMGPLQPGLPSPAMIPKDWPLIIIDLKDCFFTIPLAEQDCEKF     71 - 140
AFTIPAINNKEPATRFQWKVLPQGMLNSPTICQTFVGRALQPVRKKFSDCYIIHYIDDILCAAETKDKLI    141 - 210
DCYTFLQAEVASAGLAIASDKIQTSTPFHYLGMQIENRKIKPQKIEIRKDTLKTLNDFQKLLGDINWIQP    211 - 280
TLGIPTYAMSNLFSILRGDSDLNSKRILTPEATKEIKLVEEKIQSAQINRIDPLAPLQLLIFATAHSPTG    281 - 350
IIIQNTDLVEWSFLPHSTVKTFTLYLDQIATLIGQTRLRIIKLCGNDPDKIVVPLTKEQVRQAFINSGAW    351 - 420
QIGLANFVGIIDNHYPKTKIFQFLKLTTWILPKITRREPLENALTVFTDGSSNGKAAYTGPKERVIKTPY    421 - 490
QSAQRAELVAVITVLQDFDQPINIISDSAYVVQATRVVETALIKYSMDDQLNQLFNLLQQTVRKRNFPFY    491 - 560
ITHIRAHTNLPGPLTKANEQADLLVSSALIKAQELHALTHVNAAGLKNKFDVTWKQAKDIVQHCTQCQVL    561 - 630
HLPTQEAGVNPRGLCPNALWQMDVTHVPSFGRLSYVHVTVDTYSHFIWATCQTGESTSHVKKHLLSCFAV    631 - 700
MGVPEKIKTDNGPGYCSKAFQKFLSQWKISHTTGIPYNSQGQAIVERTNRTLKTQLVKQKEGGDSKECTT    701 - 770
PQMQLNLALYTLNFLNIYRNQTTTSAEQHLTGKKNSPHEGKLIWWKDNKNKTWEIGKVITWGRGFACVSP    771 - 840
GENQLPVWIPTRHLKFYNEPIRDAKKSTSAETETPQSSTVDSQDEQNGDVRRTDEVAIHQEGRAADLGTT    841 - 910
KEADAVSYKISREHKGDTNPREYAACSLDDCINGGKSPYACRSSCS                            911 - 956
//

Text Mined References (3)

PMID Year Title
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
17077319 2006 Identification of an infectious progenitor for the multiple-copy HERV-K human endogenous retroelements.
11591322 2001 Insertional polymorphisms of full-length endogenous retroviruses in humans.