Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
18025878 Replication-competent, particle producing, HERV-K HML-2 Type I retrovirus with foamy-virus-like properties;innate host defence mechanism to bloodborne pathogens with temporary T and B cell responses to Env
16866884 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGQTKSKIKSKYASYLSFIKILLKRGGVKVSTKNLIKLFQIIEQFCPWFPEQGTLDLKDWKRIGKELKQA      1 - 70
GRKGNIIPLTVWNDWAIIKAALEPFQTEKDSVSVSDALGSCIIDCNENTRKKSQKETEGLHCEYVAEPVM     71 - 140
AQSTQNVDYNQLQEVIYPETLKLEGKGPELVGPSESKPRGTSHLPAGQVPVTLQPQKQVKENKTQPPVAY    141 - 210
QYWPPAELQYRPPPESQYGYPGMPPAPQGRAPYPQPPTRRLNPTAPPSRQGSELHEIIDKSRKEGDTEAW    211 - 280
QFPVTLEPMPPGEGAQEGEPPTVEARYKSFSIKMLKDMKEGVKQYGPNSPYMRTLLDSIAHGHRLIPYDW    281 - 350
EILAKSSLSPSQFLQFKTWWIDGVQEQVRRNRAANPPVNIDADQLLGIGQNWSTISQQALMQNEAIEQVR    351 - 420
AICLRAWEKIQDPGSTCPSFNTVRQGSKEPYPDFVARLQDVAQKSIADEKARKVIVELMAYENANPECQS    421 - 490
AIKPLKGKVPAGSDVISEYVKACDGIGGAMHKAMLMAQAITGVVLGGQVRTFGGKCYNCGQIGHLKKNCP    491 - 560
VLNKQNITIQATTTGREPPDLCPRCKKGKHWASQCRSKFDKNGQPLSGNEQRGQPQAPQQTGAFPIQPFV    561 - 630
PQGFQEQQPPLSQVFQGISQLPQYNNCPPPQAAVQQ                                      631 - 666
//

Text Mined References (8)

PMID Year Title
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
18025878 2007 The replicative activity of human endogenous retrovirus K102 (HERV-K102) with HIV viremia.
16866884 2006 Neither an intronic CA repeat within the CD48 gene nor the HERV-K18 polymorphisms are associated with type 1 diabetes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12629516 2003 Quantitation of HERV-K env gene expression and splicing in human breast cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11401426 2001 Transcriptionally active HERV-K genes: identification, isolation, and chromosomal mapping.
10469592 1999 Many human endogenous retrovirus K (HERV-K) proviruses are unique to humans.