Knowledge Summary

Patent

No data available

AA Sequence

WASQVSENRPVCKAIIQGKQFEGLVDTEADVSIIALNQWPKNWPKQKAVTGLVGIGTASEVYQSTEILHC      1 - 70
LGPDNQESTVQPMITSIPLNLWGQDLLQQWGAEITMPAPLYSPTSQKIMTKMGYIPGKGLGKNEDGIKVP     71 - 140
VEAKINQKREGIGYPF                                                          141 - 156
//

Text Mined References (1)

PMID Year Title
10469592 1999 Many human endogenous retrovirus K (HERV-K) proviruses are unique to humans.