Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

AA Sequence

WASQVSENRPVCKAIIQGKQFEGLVDTGADVSIIALNQWPKNWPKQKAVTGLVGIGTASEVYQSTEILHC      1 - 70
LGPDNQESTVQPMITSIPLNLWGRDLLQQWGAEITMPAPLYSPTSQKIMTKMGYILGKGLGKNEDGIKIP     71 - 140
VEAKINQKREGIGYPF                                                          141 - 156
//

Text Mined References (10)

PMID Year Title