Property Summary

NCBI Gene PubMed Count 302
Grant Count 37
R01 Count 30
Funding $2,924,666.04
PubMed Score 362.28
PubTator Score 161.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

 GWAS Trait (1)

Gene RIF (126)

PMID Text
27401462 Results indicate that HuR induces 14-3-3zeta translation via interaction with its 3' UTR and that 14-3-3zeta is necessary for stimulation of intestinal epithelial cell migration after wounding.
26906158 this study suggests that the down-regulation of 14-3-3 zeta leads to the inhibition of TGFb1- induced contraction by decreasing the expression of total RhoA in TM cells.
26884855 14-3-3zeta regulates HIF-1alpha production in hepatocellular carcinoma cells by directly binding to HIF-1alpha and via PI3K/Akt/NF-small ka, CyrillicB signal transduction pathway.
26616734 CEP131 is the key regulatory target of MK2 and 14-3-3 in centriolar satellite remodeling.
26429164 loss of expression or even the down-regulation of c-abl, but not WYHAZ, is a fundamental event that leads to genesis and progression of tumors
26295714 This study provides the molecular basis for C-Raf C-terminal-derived phosphopeptide interaction with 14-3-3zeta protein and gives structural insights responsible for phosphorylation-mediated protein binding.
26205494 Activation of PCTAIRE-1 is mediated through interaction with the phosphorylated form of cyclin Y in complex with 14-3-3.
25971962 C-terminal domain of Pdc interacts with the outside surface of the 14-3-3 dimer.
25861752 14-3-3z may play an important role in signaling pathway in breast cancer. Also, a high 14-3-3z expression could positively regulate growth factor receptors and protein kinase pathways
25670079 The 14-3-3zeta-driven contextual changes of Smad partners from p53 to Gli2 may serve as biomarkers and therapeutic targets of TGF-b-mediated cancer progression.
More...

AA Sequence

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTE      1 - 70
GAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKG     71 - 140
IVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEES    141 - 210
YKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN                                       211 - 245
//

Text Mined References (323)

PMID Year Title
27401462 2016 Posttranscriptional regulation of 14-3-3? by RNA-binding protein HuR modulating intestinal epithelial restitution after wounding.
26906158 2016 Down-regulation of 14-3-3 Zeta Inhibits TGF-?1-Induced Actomyosin Contraction in Human Trabecular Meshwork Cells Through RhoA Signaling Pathway.
26884855 2015 14-3-3? up-regulates hypoxia-inducible factor-1? in hepatocellular carcinoma via activation of PI3K/Akt/NF-?B signal transduction pathway.
26616734 2015 p38- and MK2-dependent signalling promotes stress-induced centriolar satellite remodelling via 14-3-3-dependent sequestration of CEP131/AZI1.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26429164 2015 c-abl and YWHAZ gene expression in gastric cancer.
26295714 2015 Biophysical Characterization of Essential Phosphorylation at the Flexible C-Terminal Region of C-Raf with 14-3-3? Protein.
26205494 2015 Cyclin Y phosphorylation- and 14-3-3-binding-dependent activation of PCTAIRE-1/CDK16.
26047703 2015 Suppression of death-associated protein kinase 2 by interaction with 14-3-3 proteins.
25971962 2015 Structural Characterization of Phosducin and Its Complex with the 14-3-3 Protein.
More...