Property Summary

NCBI Gene PubMed Count 322
PubMed Score 390.44
PubTator Score 161.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.031 3.5e-05
adult high grade glioma -2.100 8.5e-06
astrocytic glioma -1.400 2.9e-02
Astrocytoma, Pilocytic -1.700 1.8e-06
atypical teratoid / rhabdoid tumor -2.200 2.8e-08
Breast cancer 1.100 1.2e-04
breast carcinoma 2.200 2.9e-03
ependymoma -2.000 3.2e-02
glioblastoma -1.700 6.4e-08
group 4 medulloblastoma -2.000 1.3e-05
intraductal papillary-mucinous carcinoma... 1.100 1.2e-02
invasive ductal carcinoma 1.200 3.8e-03
lung adenocarcinoma 1.166 1.5e-07
lung cancer -1.200 3.6e-03
medulloblastoma, large-cell -2.400 5.8e-05
Multiple myeloma 2.045 1.6e-03
oligodendroglioma -1.800 3.4e-02
ovarian cancer 2.500 1.4e-04
pancreatic ductal adenocarcinoma liver m... 1.308 1.5e-03
Parkinson's disease -1.100 4.6e-02
primitive neuroectodermal tumor -1.500 4.6e-04

Synonym

Accession P63104 A8K1N0 B7Z465 P29213 P29312 Q32P43 Q5XJ08 Q6GPI2 Q6IN74 Q6NUR9 Q6P3U9 Q86V33
Symbols HEL4
YWHAD
KCIP-1
HEL-S-3
HEL-S-93
14-3-3-zeta

Gene

PANTHER Protein Class (1)

PDB

4WRQ   6EJL   1IB1   1QJA   1QJB   2C1J   2C1N   2O02   2WH0   3CU8   3NKX   3RDH   4BG6   4FJ3   4HKC   4IHL   4N7G   4N7Y   4N84   4ZDR   5D2D   5D3F   5EWZ   5EXA   5J31   5JIT   5JIV   5JM4   5NAS   5WXN  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Protein-protein Interaction (2)

Gene RIF (137)

AA Sequence

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTE      1 - 70
GAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKG     71 - 140
IVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEES    141 - 210
YKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN                                       211 - 245
//

Text Mined References (344)

PMID Year Title