Property Summary

NCBI Gene PubMed Count 55
Grant Count 38
R01 Count 29
Funding $6,437,752.13
PubMed Score 362.94
PubTator Score 98.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Rheumatoid Arthritis 2.500 0.008
interstitial lung disease -1.800 0.010
astrocytic glioma -3.200 0.019
ependymoma -3.200 0.016
oligodendroglioma -3.100 0.025
psoriasis -1.400 0.002
glioblastoma -3.900 0.000
osteosarcoma -1.239 0.029
medulloblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -4.400 0.000
medulloblastoma, large-cell -4.400 0.000
primitive neuroectodermal tumor -2.600 0.000
adult high grade glioma -3.100 0.000
pilocytic astrocytoma -1.800 0.004
subependymal giant cell astrocytoma -1.982 0.040
Gaucher disease type 3 1.200 0.011

Gene RIF (35)

PMID Text
24246042 Data (including data from micro-dissected trophoblasts and trophoblastic BeWo cell line) suggest that microRNA-512-3p participates in placental function by targeting PPP3R1, encoding a regulatory subunit of calcineurin B.
24086760 HIV-1 gp120-induced dephosphorylation of KV2.1 is dependent on NMDA receptor-mediated activation of protein phosphatase 2B or calcineurin
23888774 Expression level of PPP3R1 and GATA4, and NFATC4 genes for transcription factors did not differ in studied subgroups of patients.
23727081 Further evidence that specific variations in MAPT (rs3785883) and PPP3R1 (rs1868402) are associated with accelerated progression of Alzheimer's disease
22814600 Pancreatic beta cells lacking Cnb1 fail to express genes revealed to be direct NFAT targets required for replication, insulin storage, and secretion.
22632162 HIV-1 gp120-induced dephosphorylation of KV2.1 is dependent on NMDA receptor-mediated activation of protein phosphatase 2B or calcineurin
22197822 These findings reveal a novel signaling pathway (CnB-CD11b-NF-kappaB-TRAIL) regulating TRAIL expression and may help to understand the roles of the calcineurin B subunit in the regulation of innate immunity.
21910968 CnB M118K fails to enhance the activities of NF-AT and p53 induced by CnA in HeLa-s cells.
21722668 immunostimulatory protein and acts as a vaccine adjuvant inducing protective cellular and humoral responses against pneumococcal infection
21674474 Findings demonstrate that CaN functions as a critical signaling molecule during Th cell activation, regulating Bcl-10 phosphorylation and NF-kappaB activation.
21256111 CNB binds to proteasome subunit alpha type 7 (PSMA7) and inhibits the transactivation activity of hypoxia-inducible factor-1alpha (HIF-1alpha) via the proteasome pathway.
21047202 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20862329 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20593291 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20107831 Data suggest an association between polymorphisms in PPP3CA, PPP3R1 and PPP3R2 and baseline levels or trainability of endurance phenotype traits.
20107831 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19653005 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19285944 A conserved docking surface on calcineurin mediates interaction with substrates and immunosuppressants.
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18825932 CNB gene 5I/5D polymorphism is associated with the risk of left ventricular hypertrophy and physical performance of athletes.
18818667 Study found that although calcineurin/NFAT signalling pathway has an important, non-redundant role in the regulation of lymphocyte developmental checkpoints, it is not essential for the development of blood myeloid lineages.
18422742 Overexpression of calcineurin B subunit enhances the oncogenic potential of HEK293 cells
18343007 No significant differences in calcineurin b expression was observed between patients with schizophrenia and normal controls
18296442 analysis of the secondary structure of calcineurin regulatory region and conformational change induced by calcium/calmodulin binding
18034994 Data show that the calcineurin pathway is activated in hypertrophic myocardium as demonstrated by increased calcineurin activity and expression of calcineurin A-beta and B, and GATA-4, and a shift of cytoplasmic NFAT-3 into the nucleus.
17761791 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17761791 IGF-1/PPP3R1 gene polymorphisms influence muscle phenotypic responses to strength training in both black and white older men and women.
17237284 Endothelin 1 (ET-1) activates calcineurin and causes nuclear translocation of NFATc1, implicating the pathway in the ET-1-mediated stimulation of osteoblasts.
17038582 these data imply novel functions of calcineurin and NF-kappaB for successful IS maturation.
16209992 Observational study of gene-disease association. (HuGE Navigator)
12482669 HIV-1 gp120-induced dephosphorylation of KV2.1 is dependent on NMDA receptor-mediated activation of protein phosphatase 2B or calcineurin

AA Sequence

MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV      1 - 70
DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINA     71 - 140
DKDGDGRISFEEFCAVVGGLDIHKKMVVDV                                            141 - 170
//

Text Mined References (57)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24246042 2014 Placenta-specific miRNA (miR-512-3p) targets PPP3R1 encoding the calcineurin B regulatory subunit in BeWo cells.
23888774 [Expression profile of calcineurin pathway genes in myocardium tissues in relation to ischemic heart remodeling in humans].
23727081 2014 Variants in PPP3R1 and MAPT are associated with more rapid functional decline in Alzheimer's disease: the Cache County Dementia Progression Study.
22814600 2012 Neonatal ? cell development in mice and humans is regulated by calcineurin/NFAT.
22688515 2012 Na(+)/H(+) exchanger 1 directly binds to calcineurin A and activates downstream NFAT signaling, leading to cardiomyocyte hypertrophy.
22197822 2012 The calcineurin B subunit induces TNF-related apoptosis-inducing ligand (TRAIL) expression via CD11b-NF-?B pathway in RAW264.7 macrophages.
21910968 2011 Mutation of calcineurin subunit B M118 influences the activities of NF-AT and p53, but not calcineurin expression level.
21722668 2011 Calcineurin subunit B is an immunostimulatory protein and acts as a vaccine adjuvant inducing protective cellular and humoral responses against pneumococcal infection.
21674474 2011 Dephosphorylation of Bcl-10 by calcineurin is essential for canonical NF-?B activation in Th cells.
21256111 2011 Calcineurin B subunit interacts with proteasome subunit alpha type 7 and represses hypoxia-inducible factor-1? activity via the proteasome pathway.
21047202 2010 Using genetic and clinical factors to predict tacrolimus dose in renal transplant recipients.
20862329 2010 SNPs associated with cerebrospinal fluid phospho-tau levels influence rate of decline in Alzheimer's disease.
20639889 2010 CIB1 is a regulator of pathological cardiac hypertrophy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20593291 2010 Polymorphisms in the calcineurin genes are associated with the training responsiveness of cardiac phenotypes in Chinese young adults.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20107831 2010 Are calcineurin genes associated with endurance phenotype traits?
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19896943 2009 WITHDRAWN: USP14 stabilizes calcineurin and regulates NFAT/AP-1 dependent IL-4 transcription as a novel calcineurin-binding protein.
19653005 2009 The combined impact of metabolic gene polymorphisms on elite endurance athlete status and related phenotypes.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19285944 2009 A conserved docking surface on calcineurin mediates interaction with substrates and immunosuppressants.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
18825932 2008 [The influence of calcineurin gene polymorphism on morphofunctional characteristics of cardiovascular system of athletes].
18818667 2008 Selective role of calcineurin in haematopoiesis and lymphopoiesis.
18422742 2008 Overexpression of calcineurin B subunit (CnB) enhances the oncogenic potential of HEK293 cells.
18343007 2008 Calcineurin A gamma and B gene expressions in the whole blood in Japanese patients with schizophrenia.
18296442 2008 The secondary structure of calcineurin regulatory region and conformational change induced by calcium/calmodulin binding.
18034994 Activation of the calcineurin/NFAT signalling cascade starts early in human hypertrophic myocardium.
17761791 2007 Influence of promoter region variants of insulin-like growth factor pathway genes on the strength-training response of muscle phenotypes in older adults.
17237284 2007 Endothelin signaling in osteoblasts: global genome view and implication of the calcineurin/NFAT pathway.
17038582 2007 Impairment of T cell interactions with antigen-presenting cells by immunosuppressive drugs reveals involvement of calcineurin and NF-kappaB in immunological synapse formation.
16648474 2006 Direct interaction and reciprocal regulation between ASK1 and calcineurin-NFAT control cardiomyocyte death and growth.
16473827 2006 The calcineurin phosphatase complex modulates immunogenic B cell responses.
16209992 2005 Identification of a novel 5-base pair deletion in calcineurin B (PPP3R1) promoter region and its association with left ventricular hypertrophy.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231831 2004 BAD is a pro-survival factor prior to activation of its pro-apoptotic function.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12482669 2002 Signaling pathways triggered by HIV-1 Tat in human monocytes to induce TNF-alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12357034 2002 Crystal structure of human calcineurin complexed with cyclosporin A and human cyclophilin.
12218175 2002 Crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes.
11982754 2002 Localization of calcineurin/NFAT in human skin and psoriasis and inhibition of calcineurin/NFAT activation in human keratinocytes by cyclosporin A.
11439183 2001 Signals transduced by Ca(2+)/calcineurin and NFATc3/c4 pattern the developing vasculature.
11108966 2000 Ca(2+)-binding proteins in the retina: from discovery to etiology of human disease(1).
10959817 2000 Immunolocalization of calcineurin and FKBP12, the FK506-binding protein, in Hassall's corpuscles of human thymus and epidermis.
10520753 1998 Structure of the gene coding for calcineurin B (PPP3R1) and mapping to D2S358-D2S1778 (chromosomal region 2p15).
10493818 1999 Interactions of calcineurin A, calcineurin B, and Ca2+.
10195903 1999 Ca2+-induced apoptosis through calcineurin dephosphorylation of BAD.
8978785 1996 Calcineurin A alpha (PPP3CA), calcineurin A beta (PPP3CB) and calcineurin B (PPP3R1) are located on human chromosomes 4, 10q21-->q22 and 2p16-->p15 respectively.
8524402 1995 Crystal structures of human calcineurin and the human FKBP12-FK506-calcineurin complex.
7541044 1995 Interaction of FKBP12-FK506 with calcineurin A at the B subunit-binding domain.
6330098 1984 Mammalian brain phosphoproteins as substrates for calcineurin.
2558868 1989 Isolation and sequence of a cDNA clone for human calcineurin B, the Ca2+-binding subunit of the Ca2+/calmodulin-stimulated protein phosphatase.