Property Summary

NCBI Gene PubMed Count 55
Grant Count 38
R01 Count 29
Funding $6,437,752.13
PubMed Score 362.94
PubTator Score 98.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Rheumatoid Arthritis 2.500 0.008
interstitial lung disease -1.800 0.010
astrocytic glioma -3.200 0.019
ependymoma -3.200 0.016
oligodendroglioma -3.100 0.025
psoriasis -1.400 0.002
glioblastoma -3.900 0.000
osteosarcoma -1.239 0.029
medulloblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -4.400 0.000
medulloblastoma, large-cell -4.400 0.000
primitive neuroectodermal tumor -2.600 0.000
adult high grade glioma -3.100 0.000
pilocytic astrocytoma -1.800 0.004
subependymal giant cell astrocytoma -1.982 0.040
Gaucher disease type 3 1.200 0.011

Gene RIF (35)

PMID Text
24246042 Data (including data from micro-dissected trophoblasts and trophoblastic BeWo cell line) suggest that microRNA-512-3p participates in placental function by targeting PPP3R1, encoding a regulatory subunit of calcineurin B.
24086760 HIV-1 gp120-induced dephosphorylation of KV2.1 is dependent on NMDA receptor-mediated activation of protein phosphatase 2B or calcineurin
23888774 Expression level of PPP3R1 and GATA4, and NFATC4 genes for transcription factors did not differ in studied subgroups of patients.
23727081 Further evidence that specific variations in MAPT (rs3785883) and PPP3R1 (rs1868402) are associated with accelerated progression of Alzheimer's disease
22814600 Pancreatic beta cells lacking Cnb1 fail to express genes revealed to be direct NFAT targets required for replication, insulin storage, and secretion.
22632162 HIV-1 gp120-induced dephosphorylation of KV2.1 is dependent on NMDA receptor-mediated activation of protein phosphatase 2B or calcineurin
22197822 These findings reveal a novel signaling pathway (CnB-CD11b-NF-kappaB-TRAIL) regulating TRAIL expression and may help to understand the roles of the calcineurin B subunit in the regulation of innate immunity.
21910968 CnB M118K fails to enhance the activities of NF-AT and p53 induced by CnA in HeLa-s cells.
21722668 immunostimulatory protein and acts as a vaccine adjuvant inducing protective cellular and humoral responses against pneumococcal infection
21674474 Findings demonstrate that CaN functions as a critical signaling molecule during Th cell activation, regulating Bcl-10 phosphorylation and NF-kappaB activation.
More...

AA Sequence

MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV      1 - 70
DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINA     71 - 140
DKDGDGRISFEEFCAVVGGLDIHKKMVVDV                                            141 - 170
//

Text Mined References (57)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24246042 2014 Placenta-specific miRNA (miR-512-3p) targets PPP3R1 encoding the calcineurin B regulatory subunit in BeWo cells.
23888774 [Expression profile of calcineurin pathway genes in myocardium tissues in relation to ischemic heart remodeling in humans].
23727081 2014 Variants in PPP3R1 and MAPT are associated with more rapid functional decline in Alzheimer's disease: the Cache County Dementia Progression Study.
22814600 2012 Neonatal ? cell development in mice and humans is regulated by calcineurin/NFAT.
22688515 2012 Na(+)/H(+) exchanger 1 directly binds to calcineurin A and activates downstream NFAT signaling, leading to cardiomyocyte hypertrophy.
22197822 2012 The calcineurin B subunit induces TNF-related apoptosis-inducing ligand (TRAIL) expression via CD11b-NF-?B pathway in RAW264.7 macrophages.
21910968 2011 Mutation of calcineurin subunit B M118 influences the activities of NF-AT and p53, but not calcineurin expression level.
21722668 2011 Calcineurin subunit B is an immunostimulatory protein and acts as a vaccine adjuvant inducing protective cellular and humoral responses against pneumococcal infection.
More...