Property Summary

NCBI Gene PubMed Count 115
PubMed Score 3.11
PubTator Score 10.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytoma -1.200 8.6e-08
glioblastoma -2.000 9.7e-05
oligodendroglioma -1.100 1.3e-05
atypical teratoid / rhabdoid tumor -3.100 2.3e-04
medulloblastoma, large-cell -2.200 2.7e-07
primary pancreatic ductal adenocarcinoma 1.202 2.5e-03
colon cancer -1.700 1.1e-02
breast carcinoma -1.700 1.7e-23
fibroadenoma -1.800 1.9e-02
interstitial cystitis -1.200 8.9e-03
adult high grade glioma -1.700 4.2e-04
group 3 medulloblastoma -1.100 3.4e-02
subependymal giant cell astrocytoma -2.038 6.3e-03
Pick disease -1.200 1.1e-02
Breast cancer -2.600 3.0e-08
ductal carcinoma in situ -3.000 1.3e-04
invasive ductal carcinoma -3.200 5.4e-04
acute myeloid leukemia -1.500 2.9e-02
ovarian cancer -3.600 2.0e-07
pancreatic cancer 1.300 1.1e-03

 IMPC Phenotype (1)

 GWAS Trait (1)

Gene RIF (52)

PMID Text
26258638 In activation cluster I, helices alpha1 and alpha5 pack against strands beta1-beta3 to stabilize the nucleotide-bound states.
25979337 Employed time-resolved FTIR difference spectroscopy to investigate the molecular reaction mechanisms of Galphai1. Mutants of the intrinsic arginine finger (Galphai1-R178S) affected exclusively the hydrolysis reaction.
25291362 The loss-of-function mutations of GNAI loci are rare or nonexistent in familial pituitary adenomas.
25242222 Gi alpha subunit was found to be a key modulator of GABAB-receptors signaling in analgesia.
25078664 We observed increased expression of Galphai1/3 in wounded human skin and keloid skin tissues, suggesting the possible involvement of Galphai1/3 in wound healing and keloid formation.
24914133 Data indicate that hydroxyurea (HU) induces SAR1 protein expression, which in turn activates gamma-globin expression, predominantly through the Gialpha/JNK/Jun pathway.
24415754 HIV-1 gp120-mediated phosphorylation of WAVE2 requires both G(alpha)i-dependent and -independent pathways, and is conserved both in X4 and R5 viral infection of resting CD4 T cells and primary macrophages
23841650 AC5, by binding active Galphai1, interferes with G-protein deactivation and reassembly and thereby might sensitize its own regulation.
23467353 This study support a role for RGS proteins as negative regulators of opioid supraspinal antinociception and also reveal a potential novel function of RGS proteins as positive regulators of opioid spinal antinociceptive pathways.
23404499 leucine can directly facilitate insulin signaling through a Galphai protein-dependent intracellular signaling pathway
23341447 Data suggest that chemokine binding to CCX-CKR (a) recruits Gi proteins and beta-arrestin (beta-arr) with high affinity.
23179791 Data indicate that focal adhesion kinase (FAK) activation and cell migration require Src, Gi/Go, COX-2 and LOXs activities.
23086480 resistin contributes to the pro-inflammatory state of SMC by the up-regulation of CX3CL1 and CX3CR1 expression via a mechanism involving NF-kB, AP-1, and STAT1/3 transcription factors, (2) resistin employs TLR4 and Gi-protein signaling.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22070874 CXCL12 signaling via CXCR7 is Gialpha independent.
21880739 RGS14 can form complexes with GPCRs in cells that are dependent on Galpha(i/o) and these RGS14.Galpha(i1).GPCR complexes may be substrates for other signaling partners such as Ric-8A
21654736 Galpha(o) protein contributes to maximally efficient mu-opioid receptor signaling and antinociception in Galpha(o) null transgenic mice.
20829352 Data reveal a change in the repertoire of Galpha(i/o) subunits during T cell differentiation and suggest functional equivalence among Galpha(i/o) subunits irrespective of their relative abundance.
20716524 AGS3 receptor coupling to both Galphabetagamma and GPR-Galpha(i) offer additional flexibility for systems to respond and adapt to challenges and orchestrate complex behaviors
20696855 The RET combination analysis revealed that stimulation of the alpha(2A)-adrenergic receptor (alpha(2A)AR) leads to the recruitment of GRK2 at a receptor still associated with the Galpha(i1)beta(1)gamma(2) complex.
20679342 Nucleobindin 1 is a calcium-regulated guanine nucleotide dissociation inhibitor of G{alpha}i1.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20586915 analysis of a novel Gi, P2Y-independent signaling pathway mediating Akt phosphorylation in response to thrombin receptors
20468064 Observational study of gene-disease association. (HuGE Navigator)
19951712 The chemotaxis signal pathway induced by chemokines CKbeta8 and CKbeta8-1 is mediated via the Gi/Go protein, phospholipase C (PLC) and protein kinase C delta (PKC delta).
19913121 Observational study of gene-disease association. (HuGE Navigator)
19666700 A switch in G-protein coupling, in which glutamate775lysine loses G(o) subunit coupling but retains coupling to G(i), may explain the highly specialized metabotropic glutamate receptor mGlu6 phenotype.
19494521 differentialy expressed in dendritic cells upon stimulation of with with the major house dust mite allergen Der p 1
19369247 Galpha(i1)(GDP) can bind a second Gbetagamma subunit with an affinity only 10-fold weaker than the primary site and close to the affinity between activated Galpha(i1) and Gbetagamma subunits.
18984596 Galpha.GoLoco complexes have roles in mitotic spindle dynamics
18519563 analysis of structural determinants underlying the temperature-sensitive nature of a Galpha mutant
18453587 HIV-1 gp120-mediated phosphorylation of WAVE2 requires both G(alpha)i-dependent and -independent pathways, and is conserved both in X4 and R5 viral infection of resting CD4 T cells and primary macrophages
18378672 MUPP1 binds to the G protein-coupled MT(1) melatonin receptor and directly regulates its G(i)-dependent signal transduction
18083345 The potency and efficacy of LPA-mediated inhibition of forskolin-stimulated adenylyl cyclase activity was enhanced in cells expressing RGSi G(i) (mutant) proteins as compared to RGSwt G(i).
18037379 Heretotrimeric G protein subunit Galphai is associated with mitochondria.
17646583 Selective induction of G alpha inhibiting subunit 1 (Gi alpha1) expression is a novel downstream event in hypertrophic signaling that may be a critical factor leading to cellular electrophysiological remodeling of the Ras transgenic mouse heart.
17416965 Data show that Gi and RGS proteins provide biochemical control of androgen receptor exclusion from the cell nucleus.
17267663 These data revealed that PAR1 can be part of a preassembled complex with Galpha(i1) protein, resulting either from a direct interaction between these partners or from their colocalization in specific microdomains.
17013094 autotaxin induces uPA expression via the Gi-PI3K-Akt-NF-kappaB signaling pathway that might be critical for autotaxin-induced tumor cell invasion and metastasis
16775006 Nef protein of human immunodeficiency virus (HIV) reduces cell surface levels of eight different members of the CC- and CXC-family of Chemokine receptors (CKRs) by up to 92%.
16371464 Gialpha and Gbeta subunits both define selectivity of G protein activation by alpha2-adrenergic receptors.
15972662 HIV-1 gp120-mediated phosphorylation of WAVE2 requires both G(alpha)i-dependent and -independent pathways, and is conserved both in X4 and R5 viral infection of resting CD4 T cells and primary macrophages
15863506 TPO integrates G(i), but not G(q), stimulation, supports integrin alpha(IIb)beta(3) activation platelet aggregation independently of phospholipase C but requires PI3-kinase and Rap1B
15837785 G12, Rho, filamin-A, and the actin cytoskeleton are required for amino acid-stimulated Ca2+ oscillations produced by the Ca2+-sensing receptor
15657046 the G(alpha)o/i-coupled cannabinoid receptor, by regulating the proteasomal degradation of Rap1GAPII, activates Rap1 to induce neurite outgrowth.
14625285 Gi has a role in CXCL16 signaling that induces cell-cell adhesion and aortic smooth muscle cell proliferation
14623889 Gi, but not Gq or G12/13, signaling pathways are required for activation of Akt in platelets
14602724 Gi has a role in insulin attenuation of platelet functions by interfering with cAMP suppression along with IRS-1
14581469 region of the third cytoplasmic loop of Dopamine D2 receptor is crucial for determining G(i) protein coupling specificity.
14576516 An age-induced increase in G alpha i may have a role in depressing cardiac function in aged human atria.
12297512 co-stimulation of G(12/13) and G(i) pathways is sufficient to activate GPIIb/IIIa in human platelets in a mechanism that involves intracellular calcium
11976690 Structural determinants for GoLoco-induced inhibition of nucleotide release by Galpha subunits

AA Sequence

MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYK      1 - 70
AVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACF     71 - 140
NRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKK    141 - 210
WIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKK    211 - 280
SPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKD    281 - 350
CGLF                                                                      351 - 354
//

Text Mined References (126)

PMID Year Title
26258638 2015 Probing G?i1 protein activation at single-amino acid resolution.
25979337 2015 Integration of Fourier Transform Infrared Spectroscopy, Fluorescence Spectroscopy, Steady-state Kinetics and Molecular Dynamics Simulations of G?i1 Distinguishes between the GTP Hydrolysis and GDP Release Mechanism.
25416956 2014 A proteome-scale map of the human interactome network.
25291362 2014 Mutation analysis of inhibitory guanine nucleotide binding protein alpha (GNAI) loci in young and familial pituitary adenomas.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25242222 2014 GINIP, a G?i-interacting protein, functions as a key modulator of peripheral GABAB receptor-mediated analgesia.
25078664 2015 Requirement of G?i1/3-Gab1 signaling complex for keratinocyte growth factor-induced PI3K-AKT-mTORC1 activation.
24914133 2014 Hydroxyurea-inducible SAR1 gene acts through the Gi?/JNK/Jun pathway to regulate ?-globin expression.
24141704 2013 A bacterial toxin catalyzing tyrosine glycosylation of Rho and deamidation of Gq and Gi proteins.
23841650 2013 Dynamics of G?i1 interaction with type 5 adenylate cyclase reveal the molecular basis for high sensitivity of Gi-mediated inhibition of cAMP production.
23467353 2013 Differential control of opioid antinociception to thermal stimuli in a knock-in mouse expressing regulator of G-protein signaling-insensitive G?o protein.
23404499 2013 Leucine facilitates insulin signaling through a G?i protein-dependent signaling pathway in hepatocytes.
23341447 2013 ?-Arrestin recruitment and G protein signaling by the atypical human chemokine decoy receptor CCX-CKR.
23179791 2013 Role of LOXs and COX-2 on FAK activation and cell migration induced by linoleic acid in MDA-MB-231 breast cancer cells.
23086480 2013 Inflammatory effects of resistin on human smooth muscle cells: up-regulation of fractalkine and its receptor, CX3CR1 expression by TLR4 and Gi-protein pathways.
22952234 2012 Crystal structures of the scaffolding protein LGN reveal the general mechanism by which GoLoco binding motifs inhibit the release of GDP from G?i.
22408789 2012 Retraction for Johnston and Siderovski. Structural basis for nucleotide exchange on G?i subunits and receptor coupling specificity.
22383884 2012 A P-loop mutation in G? subunits prevents transition to the active state: implications for G-protein signaling in fungal pathogenesis.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22070874 2012 CXCR7 mediated Gi? independent activation of ERK and Akt promotes cell survival and chemotaxis in T cells.
21880739 2011 G protein-coupled receptors and resistance to inhibitors of cholinesterase-8A (Ric-8A) both regulate the regulator of g protein signaling 14 RGS14·G?i1 complex in live cells.
21654736 2011 ?-Opioid receptor coupling to G?(o) plays an important role in opioid antinociception.
21269460 2011 Initial characterization of the human central proteome.
21115486 2011 Structural determinants of affinity enhancement between GoLoco motifs and G-protein alpha subunit mutants.
20829352 2010 Differentiation of human T cells alters their repertoire of G protein alpha-subunits.
20716524 2010 Regulation of the AGS3·G{alpha}i signaling complex by a seven-transmembrane span receptor.
20696855 2010 Combining resonance energy transfer methods reveals a complex between the alpha2A-adrenergic receptor, Galphai1beta1gamma2, and GRK2.
20679342 2010 Nucleobindin 1 is a calcium-regulated guanine nucleotide dissociation inhibitor of G{alpha}i1.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20586915 2010 A G(i) -independent mechanism mediating Akt phosphorylation in platelets.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20213681 2010 Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system.
19951712 2010 CK beta 8/CCL23 induces cell migration via the Gi/Go protein/PLC/PKC delta/NF-kappa B and is involved in inflammatory responses.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19666700 2009 Altered G-protein coupling in an mGluR6 point mutant associated with congenital stationary night blindness.
19641626 2009 Local network topology in human protein interaction data predicts functional association.
19494521 2009 Differential protein expression by dendritic cells from atopic and non-atopic individuals after stimulation by the major house dust mite allergen Der p 1.
19369247 2009 Evidence for a second, high affinity Gbetagamma binding site on Galphai1(GDP) subunits.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18984596 2008 A point mutation to Galphai selectively blocks GoLoco motif binding: direct evidence for Galpha.GoLoco complexes in mitotic spindle dynamics.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18519563 2008 Structural determinants underlying the temperature-sensitive nature of a Galpha mutant in asymmetric cell division of Caenorhabditis elegans.
18434541 2008 Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.
18378672 2008 The PDZ protein mupp1 promotes Gi coupling and signaling of the Mt1 melatonin receptor.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18083345 2008 Endogenous RGS proteins attenuate Galpha(i)-mediated lysophosphatidic acid signaling pathways in ovarian cancer cells.
18037379 2007 The heterotrimeric [corrected] G protein subunit G alpha i is present on mitochondria.
17897319 2007 Integral and associated lysosomal membrane proteins.
17646583 2007 Gi alpha 1-mediated cardiac electrophysiological remodeling and arrhythmia in hypertrophic cardiomyopathy.
17635935 2007 Localization of Gi alpha proteins in the centrosomes and at the midbody: implication for their role in cell division.
17603074 2007 Structure-based protocol for identifying mutations that enhance protein-protein binding affinities.
17416965 2007 Gi and RGS proteins provide biochemical control of androgen receptor nuclear exclusion.
17267663 2007 Real-time analysis of agonist-induced activation of protease-activated receptor 1/Galphai1 protein complex measured by bioluminescence resonance energy transfer in living cells.
17264214 2007 Structural basis for nucleotide exchange on G alpha i subunits and receptor coupling specificity.
17013094 2006 Autotaxin stimulates urokinase-type plasminogen activator expression through phosphoinositide 3-kinase-Akt-nuclear [corrected] factor kappa B signaling cascade in human melanoma cells.
16892066 2006 Mechanism of the receptor-catalyzed activation of heterotrimeric G proteins.
16775006 2006 The Nef protein of human immunodeficiency virus is a broad-spectrum modulator of chemokine receptor cell surface levels that acts independently of classical motifs for receptor endocytosis and Galphai signaling.
16381901 2006 The LIFEdb database in 2006.
16371464 2006 Gialpha and Gbeta subunits both define selectivity of G protein activation by alpha2-adrenergic receptors.
16004878 2005 Structure of Galpha(i1) bound to a GDP-selective peptide provides insight into guanine nucleotide exchange.
15863506 2005 Thrombopoietin complements G(i)- but not G(q)-dependent pathways for integrin {alpha}(IIb){beta}(3) activation and platelet aggregation.
15837785 2005 Amino acid-stimulated Ca2+ oscillations produced by the Ca2+-sensing receptor are mediated by a phospholipase C/inositol 1,4,5-trisphosphate-independent pathway that requires G12, Rho, filamin-A, and the actin cytoskeleton.
15657046 2005 Cannabinoid receptor-induced neurite outgrowth is mediated by Rap1 activation through G(alpha)o/i-triggered proteasomal degradation of Rap1GAPII.
15537540 2004 Mammalian Pins is a conformational switch that links NuMA to heterotrimeric G proteins.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15242332 2004 Vectorial proteomics reveal targeting, phosphorylation and specific fragmentation of polymerase I and transcript release factor (PTRF) at the surface of caveolae in human adipocytes.
14993377 2002 Isoforms of mammalian adenylyl cyclase: multiplicities of signaling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14625285 2004 CXCL16 signals via Gi, phosphatidylinositol 3-kinase, Akt, I kappa B kinase, and nuclear factor-kappa B and induces cell-cell adhesion and aortic smooth muscle cell proliferation.
14623889 2004 Akt activation in platelets depends on Gi signaling pathways.
14602724 2004 IRS-1 mediates inhibition of Ca2+ mobilization by insulin via the inhibitory G-protein Gi.
14581469 2004 A region of the third intracellular loop of the short form of the D2 dopamine receptor dictates Gi coupling specificity.
14576516 2003 Age increases expression and receptor-mediated activation of G alpha i in human atria.
14530282 2003 Thermodynamic characterization of the binding of activator of G protein signaling 3 (AGS3) and peptides derived from AGS3 with G alpha i1.
12853948 2003 The DNA sequence of human chromosome 7.
12711604 2003 Functional characterization of human receptors for short chain fatty acids and their role in polymorphonuclear cell activation.
12629551 2003 Free fatty acids regulate insulin secretion from pancreatic beta cells through GPR40.
12496284 2003 The orphan G protein-coupled receptor GPR40 is activated by medium and long chain fatty acids.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12297512 2002 Coordinated signaling through both G12/13 and G(i) pathways is sufficient to activate GPIIb/IIIa in human platelets.
12068084 2002 Agonists activate Gi1 alpha or Gi2 alpha fused to the human mu opioid receptor differently.
11976690 2002 Structural determinants for GoLoco-induced inhibition of nucleotide release by Galpha subunits.
11955952 2002 Cloning and characterization of a novel regulator of G protein signalling in human platelets.
11916537 Multiplicity of mechanisms of serotonin receptor signal transduction.
11732925 2001 Serine 232 of the alpha(2A)-adrenergic receptor is a protein kinase C-sensitive effector coupling switch.
11507164 2001 Interaction between the RGS domain of RGS4 with G protein alpha subunits mediates the voltage-dependent relaxation of the G protein-gated potassium channel.
11387333 2001 RGS12 and RGS14 GoLoco motifs are G alpha(i) interaction sites with guanine nucleotide dissociation inhibitor Activity.
11259487 2001 Coincident signalling between the Gi/Go-coupled delta-opioid receptor and the Gq-coupled m3 muscarinic receptor at the level of intracellular free calcium in SH-SY5Y cells.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11196645 2001 Identification of the platelet ADP receptor targeted by antithrombotic drugs.
11168387 2001 CB1 receptor-G protein association. Subtype selectivity is determined by distinct intracellular domains.
11118617 2000 Cloning and characterization of the human phosphoinositide-specific phospholipase C-beta 1 (PLC beta 1).
11076863 2000 DNA cloning using in vitro site-specific recombination.
10978845 2000 Coupling of dopamine receptor subtypes to multiple and diverse G proteins.
10690676 2000 Inhibitory G protein alpha subunit (Gi alpha) expression and localization during human trophoblast differentiation.
10644671 2000 Association of heterotrimeric G(i) with the insulin-like growth factor-I receptor. Release of G(betagamma) subunits upon receptor activation.
10598591 1999 A novel spliced variant of the type 1 corticotropin-releasing hormone receptor with a deletion in the seventh transmembrane domain present in the human pregnant term myometrium and fetal membranes.
10488065 1999 Differential coupling of the sphingosine 1-phosphate receptors Edg-1, Edg-3, and H218/Edg-5 to the G(i), G(q), and G(12) families of heterotrimeric G proteins.
10471510 1999 Ocular albinism: evidence for a defect in an intracellular signal transduction system.
10364213 1999 Structural basis for the selectivity of the RGS protein, GAIP, for Galphai family members. Identification of a single amino acid determinant for selective interaction of Galphai subunits with GAIP.
9748257 1998 Identification of a Gialpha binding site on type V adenylyl cyclase.
9660808 1998 Expression of GTPase-deficient Gialpha2 results in translocation of cytoplasmic RGS4 to the plasma membrane.
9572280 1998 RGS7 attenuates signal transduction through the G(alpha q) family of heterotrimeric G proteins in mammalian cells.
9207071 1997 The regulators of G protein signaling (RGS) domains of RGS4, RGS10, and GAIP retain GTPase activating protein activity in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8986788 1996 GAIP is membrane-anchored by palmitoylation and interacts with the activated (GTP-bound) form of G alpha i subunits.
8774883 1996 RGS10 is a selective activator of G alpha i GTPase activity.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8552586 1996 The human thyrotropin receptor: a heptahelical receptor capable of stimulating members of all four G protein families.
8521505 1995 The structure of the G protein heterotrimer Gi alpha 1 beta 1 gamma 2.
8504751 1993 Identification and expression of G-proteins in human myometrium: up-regulation of G alpha s in pregnancy.
8208289 1994 Structural determinants for activation of the alpha-subunit of a heterotrimeric G protein.
8183236 1994 Gi alpha 1 selectively couples somatostatin receptor subtype 3 to adenylyl cyclase: identification of the functional domains of this alpha subunit necessary for mediating the inhibition by somatostatin of cAMP formation.
8107314 1994 Identification of GTP-binding proteins in human glomeruli.
7937899 1994 Mechanism of GTP hydrolysis by G-protein alpha subunits.
7914078 1994 Human somatostatin receptor, SSTR2, is coupled to adenylyl cyclase in the presence of Gi alpha 1 protein.
3139448 1988 GTP-binding proteins in human platelet membranes serving as the specific substrate of islet-activating protein, pertussis toxin.
3130752 1988 The gene for the alpha i1 subunit of human guanine nucleotide binding protein maps near the cystic fibrosis locus.
3110783 1987 Human cDNA clones for an alpha subunit of Gi signal-transduction protein.
3092218 1986 Inhibitory and stimulatory G proteins of adenylate cyclase: cDNA and amino acid sequences of the alpha chains.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.
2440724 1987 The human genome encodes at least three non-allellic G proteins with alpha i-type subunits.
1953657 1991 Thrombin inhibits the pertussis-toxin-dependent ADP-ribosylation of a novel soluble Gi-protein in human platelets.
1902575 1991 Guanine nucleotide-binding regulatory proteins in retinal pigment epithelial cells.