Property Summary

NCBI Gene PubMed Count 115
Grant Count 1
Funding $32,550
PubMed Score 3.11
PubTator Score 10.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytoma -1.200 0.000
glioblastoma -2.000 0.000
oligodendroglioma -1.100 0.000
atypical teratoid / rhabdoid tumor -3.100 0.000
medulloblastoma, large-cell -2.200 0.000
primary pancreatic ductal adenocarcinoma 1.202 0.002
colon cancer -1.700 0.011
breast carcinoma -1.700 0.000
fibroadenoma -1.800 0.019
interstitial cystitis -1.200 0.009
adult high grade glioma -1.700 0.000
group 3 medulloblastoma -1.100 0.034
subependymal giant cell astrocytoma -2.038 0.006
Pick disease -1.200 0.011
Breast cancer -2.600 0.000
ductal carcinoma in situ -3.000 0.000
invasive ductal carcinoma -3.200 0.001
acute myeloid leukemia -1.500 0.029
ovarian cancer -3.600 0.000
pancreatic cancer 1.300 0.001

Gene

 Grant Application (1)

PDB

2OM2   2XNS   3ONW   3QI2   1KJY   1Y3A   2G83   2GTP   2IK8   3QE0   3UMR   3UMS   4G5Q   5JS7   5JS8  

 GWAS Trait (1)

Gene RIF (52)

PMID Text
26258638 In activation cluster I, helices alpha1 and alpha5 pack against strands beta1-beta3 to stabilize the nucleotide-bound states.
25979337 Employed time-resolved FTIR difference spectroscopy to investigate the molecular reaction mechanisms of Galphai1. Mutants of the intrinsic arginine finger (Galphai1-R178S) affected exclusively the hydrolysis reaction.
25291362 The loss-of-function mutations of GNAI loci are rare or nonexistent in familial pituitary adenomas.
25242222 Gi alpha subunit was found to be a key modulator of GABAB-receptors signaling in analgesia.
25078664 We observed increased expression of Galphai1/3 in wounded human skin and keloid skin tissues, suggesting the possible involvement of Galphai1/3 in wound healing and keloid formation.
24914133 Data indicate that hydroxyurea (HU) induces SAR1 protein expression, which in turn activates gamma-globin expression, predominantly through the Gialpha/JNK/Jun pathway.
24415754 HIV-1 gp120-mediated phosphorylation of WAVE2 requires both G(alpha)i-dependent and -independent pathways, and is conserved both in X4 and R5 viral infection of resting CD4 T cells and primary macrophages
23841650 AC5, by binding active Galphai1, interferes with G-protein deactivation and reassembly and thereby might sensitize its own regulation.
23467353 This study support a role for RGS proteins as negative regulators of opioid supraspinal antinociception and also reveal a potential novel function of RGS proteins as positive regulators of opioid spinal antinociceptive pathways.
23404499 leucine can directly facilitate insulin signaling through a Galphai protein-dependent intracellular signaling pathway
More...

AA Sequence

MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYK      1 - 70
AVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACF     71 - 140
NRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKK    141 - 210
WIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKK    211 - 280
SPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKD    281 - 350
CGLF                                                                      351 - 354
//

Text Mined References (126)

PMID Year Title
26258638 2015 Probing G?i1 protein activation at single-amino acid resolution.
25979337 2015 Integration of Fourier Transform Infrared Spectroscopy, Fluorescence Spectroscopy, Steady-state Kinetics and Molecular Dynamics Simulations of G?i1 Distinguishes between the GTP Hydrolysis and GDP Release Mechanism.
25416956 2014 A proteome-scale map of the human interactome network.
25291362 2014 Mutation analysis of inhibitory guanine nucleotide binding protein alpha (GNAI) loci in young and familial pituitary adenomas.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25242222 2014 GINIP, a G?i-interacting protein, functions as a key modulator of peripheral GABAB receptor-mediated analgesia.
25078664 2015 Requirement of G?i1/3-Gab1 signaling complex for keratinocyte growth factor-induced PI3K-AKT-mTORC1 activation.
24914133 2014 Hydroxyurea-inducible SAR1 gene acts through the Gi?/JNK/Jun pathway to regulate ?-globin expression.
24141704 2013 A bacterial toxin catalyzing tyrosine glycosylation of Rho and deamidation of Gq and Gi proteins.
23841650 2013 Dynamics of G?i1 interaction with type 5 adenylate cyclase reveal the molecular basis for high sensitivity of Gi-mediated inhibition of cAMP production.
More...