Property Summary

NCBI Gene PubMed Count 438
PubMed Score 1389.74
PubTator Score 1344.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Kidney disease 430 0.0 3.0
substance-related disorder 162 0.0 0.9
Disease Target Count Z-score Confidence
Cancer 2499 4.074 2.0
Cushing's syndrome 48 3.595 1.8
Obesity 678 3.531 1.8

Protein-protein Interaction (11)

Gene RIF (351)

AA Sequence

MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNG      1 - 70
EGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDF     71 - 140
DFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFET    141 - 210
KFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNR    211 - 280
WLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRIST    281 - 350
ASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL                              351 - 394
//

Text Mined References (452)

PMID Year Title