Property Summary

NCBI Gene PubMed Count 85
Grant Count 165
R01 Count 107
Funding $11,821,117.3
PubMed Score 310.31
PubTator Score 200.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis -1.400 0.027
astrocytic glioma -1.700 0.003
posterior fossa group B ependymoma -2.500 0.000
psoriasis -3.700 0.000
glioblastoma -1.800 0.000
oligodendroglioma -1.200 0.000
osteosarcoma -1.925 0.000
group 3 medulloblastoma -2.500 0.001
lung cancer -1.400 0.000
pediatric high grade glioma -1.200 0.003
atypical teratoid/rhabdoid tumor -1.500 0.000
pilocytic astrocytoma -1.100 0.016
subependymal giant cell astrocytoma -1.867 0.004
Gaucher disease type 1 1.900 0.025

Synonym

Accession P63027 P19065 Q9BUC2 VAMP-2
Symbols SYB2
VAMP-2

Gene

PDB

3FIE   3FII   3RK2   3RK3   3RL0  

Gene RIF (27)

PMID Text
26639969 This study showed that decreased Levels of VAMP2 correlate with Duration of Dementia.
26412491 A large vesicular pool of VAMP2 maintained by AP180 is crucial to sustain efficient neurotransmission.
26134228 VAMP2-NRG1 is a novel oncogenic fusion gene representing a new addition to the list of NRG1 fusion genes, which together may form an important diagnostic and clinical category of lung adenocarcinoma cases
25481410 miR-206 regulates lung surfactant secretion by limiting the availability of VAMP-2 protein.
25445064 SNARE complex genes and their interactions may play a significant role in susceptibility and working memory of ADHD.
24164654 The genetic variations of VAMP2, Synaptotagmin XI might be indication of the relationship between these genes and idiopathic generalized epilepsy
22172278 BoNT/F5 cleaves substrate synaptobrevin-2 in a different location than the other BoNT/F subtypes, between (54)L and (55)E.
21808019 unique mechanism of SNARE motif-dependent endocytic sorting and identify the ANTH domain proteins AP180 and CALM as cargo-specific adaptors for synaptobrevin 2 endocytosis
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADAL      1 - 70
QAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST                             71 - 116
//

Text Mined References (87)

PMID Year Title
26639969 2016 Decreased Levels of VAMP2 and Monomeric Alpha-Synuclein Correlate with Duration of Dementia.
26412491 2015 Vesicular Synaptobrevin/VAMP2 Levels Guarded by AP180 Control Efficient Neurotransmission.
26134228 2015 VAMP2-NRG1 Fusion Gene is a Novel Oncogenic Driver of Non-Small-Cell Lung Adenocarcinoma.
25481410 2015 MicroRNA-206 regulates surfactant secretion by targeting VAMP-2.
25445064 2015 Synaptosome-related (SNARE) genes and their interactions contribute to the susceptibility and working memory of attention-deficit/hyperactivity disorder in males.
25416956 2014 A proteome-scale map of the human interactome network.
24164654 2014 Genetic variants of synaptic vesicle and presynaptic plasma membrane proteins in idiopathic generalized epilepsy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22375059 2012 Different effects of Sec61?, Sec62 and Sec63 depletion on transport of polypeptides into the endoplasmic reticulum of mammalian cells.
22172278 2012 Discovery of a novel enzymatic cleavage site for botulinum neurotoxin F5.
More...