Property Summary

NCBI Gene PubMed Count 92
PubMed Score 323.71
PubTator Score 200.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.200 1.7e-02
astrocytic glioma -1.600 1.3e-03
Astrocytoma, Pilocytic -1.100 1.5e-02
atypical teratoid/rhabdoid tumor -1.400 8.7e-05
ependymoma -1.500 1.9e-02
Gaucher disease type 1 1.900 2.5e-02
glioblastoma -1.600 2.9e-06
group 3 medulloblastoma -2.000 1.9e-03
lung cancer -1.100 6.7e-03
oligodendroglioma -1.100 9.6e-10
osteosarcoma -1.819 1.5e-03
psoriasis -3.000 8.1e-04
Rheumatoid arthritis -1.400 2.7e-02
subependymal giant cell astrocytoma -1.467 4.1e-02

Protein-protein Interaction (6)

Gene RIF (32)

AA Sequence

MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADAL      1 - 70
QAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST                             71 - 116
//

Text Mined References (94)

PMID Year Title