Property Summary

NCBI Gene PubMed Count 49
PubMed Score 34.84
PubTator Score 22.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 2.600 2.4e-02
esophageal adenocarcinoma 1.100 2.0e-02
head and neck cancer and chronic obstruc... -1.300 2.1e-02
interstitial lung disease -1.200 2.0e-02
oligodendroglioma 1.100 6.7e-03
ovarian cancer -1.700 2.7e-07

Protein-protein Interaction (2)

Gene RIF (29)

AA Sequence

MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVY      1 - 70
LYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKT     71 - 140
AAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTA    141 - 210
LNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNML    211 - 280
LKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQAN    281 - 350
IAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK    351 - 420
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVK    421 - 490
LFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLL    491 - 560
DELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGD    561 - 630
LLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGI    631 - 700
GMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPL    701 - 770
AIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLAT    771 - 840
WKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNP    841 - 910
NYTLSLKCRAPEVSQYIYQVYDSILKN                                               911 - 937
//

Text Mined References (70)

PMID Year Title