Property Summary

NCBI Gene PubMed Count 46
Grant Count 13
R01 Count 13
Funding $1,313,652.42
PubMed Score 75.10
PubTator Score 22.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial lung disease -1.200 0.020
oligodendroglioma 1.100 0.007
esophageal adenocarcinoma 1.100 0.020
Breast cancer 2.600 0.024
ovarian cancer 2.000 0.000
head and neck cancer and chronic obstruc... -1.300 0.021

 GWAS Trait (1)

Gene RIF (32)

PMID Text
26269175 HIV-1 Env gp41 requires the conserved membrane-proximal AP2B1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
25061211 this study determined a structure of AP2 that includes the clathrin-binding beta2 hinge.
23705972 HIV-1 Env gp41 requires the conserved membrane-proximal AP2B1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
23077317 HIV-1 Env gp41 requires the conserved membrane-proximal AP2B1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
23077317 HIV-1 Env gp41 requires the conserved membrane-proximal AP2B1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
22632162 HIV-1 Env gp41 requires the conserved membrane-proximal AP2B1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22103831 HIV-1 Env gp41 requires the conserved membrane-proximal AP2B1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
21762802 HIV-1 Env gp41 requires the conserved membrane-proximal AP2B1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
21762802 HIV-1 Env gp41 requires the conserved membrane-proximal AP2B1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
More...

AA Sequence

MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVY      1 - 70
LYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKT     71 - 140
AAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTA    141 - 210
LNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNML    211 - 280
LKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQAN    281 - 350
IAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK    351 - 420
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVK    421 - 490
LFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLL    491 - 560
DELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGD    561 - 630
LLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGI    631 - 700
GMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPL    701 - 770
AIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLAT    771 - 840
WKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNP    841 - 910
NYTLSLKCRAPEVSQYIYQVYDSILKN                                               911 - 937
//

Text Mined References (67)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25061211 2014 Clathrin adaptors. AP2 controls clathrin polymerization with a membrane-activated switch.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22484487 2012 Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21269460 2011 Initial characterization of the human central proteome.
More...