Property Summary

NCBI Gene PubMed Count 46
PubMed Score 75.10
PubTator Score 22.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Platelet mean volume finding 31
Disease Target Count P-value
ovarian cancer 8492 3.62545940733387E-5
oligodendroglioma 2849 0.00668146297426706
interstitial lung disease 292 0.0199573999118839
esophageal adenocarcinoma 737 0.0200190588680455
head and neck cancer and chronic obstructive pulmonary disease 237 0.0208567069888265
Breast cancer 3099 0.0242437391459974
Disease Target Count Z-score Confidence
Eating disorder 24 3.097 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial lung disease -1.200 0.020
oligodendroglioma 1.100 0.007
esophageal adenocarcinoma 1.100 0.020
Breast cancer 2.600 0.024
ovarian cancer 2.000 0.000
head and neck cancer and chronic obstruc... -1.300 0.021

Synonym

Accession P63010 A6NJP3 P21851 Q7Z451 Q96J19
Symbols ADTB2
AP105B
CLAPB1
AP2-BETA

Gene

PANTHER Protein Class (1)

PDB

2IV9   1E42   2G30   2IV8   2JKR   2JKT   2VGL   2XA7   4UQI  

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

 GWAS Trait (1)

Gene RIF (29)

PMID Text
26269175 HIV-1 Env gp41 requires the conserved membrane-proximal AP2B1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
25061211 this study determined a structure of AP2 that includes the clathrin-binding beta2 hinge.
23705972 HIV-1 Env gp41 requires the conserved membrane-proximal AP2B1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
23077317 HIV-1 Env gp41 requires the conserved membrane-proximal AP2B1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
22632162 HIV-1 Env gp41 requires the conserved membrane-proximal AP2B1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22103831 HIV-1 Env gp41 requires the conserved membrane-proximal AP2B1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
21762802 HIV-1 Env gp41 requires the conserved membrane-proximal AP2B1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
20594957 HIV-1 Env gp41 requires the conserved membrane-proximal AP2B1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
20012524 HIV-1 Env gp41 requires the conserved membrane-proximal AP2B1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
More...

AA Sequence

MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVY      1 - 70
LYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKT     71 - 140
AAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTA    141 - 210
LNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNML    211 - 280
LKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQAN    281 - 350
IAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK    351 - 420
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVK    421 - 490
LFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLL    491 - 560
DELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGD    561 - 630
LLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGI    631 - 700
GMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPL    701 - 770
AIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLAT    771 - 840
WKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNP    841 - 910
NYTLSLKCRAPEVSQYIYQVYDSILKN                                               911 - 937
//

Text Mined References (67)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25061211 2014 Clathrin adaptors. AP2 controls clathrin polymerization with a membrane-activated switch.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22484487 2012 Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21269460 2011 Initial characterization of the human central proteome.
More...