Property Summary

NCBI Gene PubMed Count 818
Grant Count 1,349
R01 Count 890
Funding $93,463,129.7
PubMed Score 73.47
PubTator Score 1695.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession P63000 O95501 P15154 Q3Y4D3 Q5JAA8 Q9BTB4
Symbols MIG5
Rac-1
TC-25
p21-Rac1

Gene

PDB

3SU8   3SUA   1I4D   1I4L   1I4T   2FJU   3BJI   1E96   1FOE   1G4U   1HE1   1HH4   1MH1   1RYF   1RYH   2H7V   2NZ8   2P2L   2RMK   2VRW   2WKP   2WKQ   2WKR   2YIN   3B13   3RYT   3SBD   3SBE   3TH5   4GZL   4GZM   4YON   5FI0  

Gene RIF (650)

PMID Text
27189938 This study also showed that, despite the conservation of the catalytic activity of RhoGAP (Rho-specific GAP) on the 6-TGTP-Rac1 adduct to produce the biologically inactive 6-thioguanosine diphosphate (6-TGDP)-Rac1 adduct, RhoGEF (Rho-specific GEF) cannot exchange the 6-TGDP adducted on Rac1 with free guanine nucleotide.
27151455 Activated Rac1 regulates the degradation of IkappaBalpha and the nuclear translocation of STAT3-NFkappaB complexes in starved cancer cells
26905694 Loss of FAT1 results in decreased cell adhesion and migration in fibroblasts and podocytes and the decreased migration is partially reversed by a RAC1/CDC42 activator.
26867574 RAC1/RAC2 and SFK are proximal and essential for phosphatidylinositol 3-kinase (PI3K) activation in NK cell-mediated direct cytotoxicity against Cryptococcus neoformans.
26841219 This study suggested that polymorphisms of RAC1 gene might influence the susceptibility to end-stage renal disease in Chinese Han population.
26752742 inhibition of FAK phosphorylation at Y397 or Rac1 activity can serve as a therapeutic strategy for treating patients with metastatic oral squamous cell carcinoma
26740622 Data suggest LPA (lysophosphatidic acid; acting via LPAR1) and endothelin activate Cdc42, concurrent with biphasic decrease in Rac1 activity, differential effects on RhoA; LPA/endothelin stim. leads to remodeling of invadosomes in melanoma cells.
26648292 Rab23 enhance squamous cell carcinoma cell invasion via up-regulating Rac1.
26634649 we discovered distinct predictive performance of Rac1 and Cdc42 depending on the migration modes, indicating that Rac1 and Cdc42 contribute to persistent and random migration, respectively
26617787 RAC1 overexpression promoted the proliferation of lens epithelial cells. RAC1 overexpression also promoted migration and invasion of lens epithelial cells and had an influence on the epithelial-mesenchymal transition process.
More...

AA Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPL      1 - 70
SYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYP     71 - 140
QGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL                      141 - 192
//

Text Mined References (836)

PMID Year Title
27189938 2016 Thiopurine Prodrugs Mediate Immunosuppressive Effects by Interfering with Rac1 Protein Function.
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27151455 2016 Activated Rac1 regulates the degradation of I?B? and the nuclear translocation of STAT3-NF?B complexes in starved cancer cells.
26905694 2016 FAT1 mutations cause a glomerulotubular nephropathy.
26867574 2016 Ras-related C3 Botulinum Toxin Substrate (Rac) and Src Family Kinases (SFK) Are Proximal and Essential for Phosphatidylinositol 3-Kinase (PI3K) Activation in Natural Killer (NK) Cell-mediated Direct Cytotoxicity against Cryptococcus neoformans.
26841219 2016 Association of RAC1 Gene Polymorphisms with Primary End-Stage Renal Disease in Chinese Renal Recipients.
26752742 2016 Tyrosine 397 phosphorylation is critical for FAK-promoted Rac1 activation and invasive properties in oral squamous cell carcinoma cells.
26740622 2016 Rapid Remodeling of Invadosomes by Gi-coupled Receptors: DISSECTING THE ROLE OF Rho GTPases.
26648292 2015 [Rab23 enhances invasion of Sa3 cutaneous squamous cell carcinoma cells via up-regulating the expression of Rac1].
26634649 2015 Distinct predictive performance of Rac1 and Cdc42 in cell migration.
More...