Property Summary

NCBI Gene PubMed Count 892
PubMed Score 87.11
PubTator Score 1695.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
group 4 medulloblastoma 1.300 4.8e-02
intraductal papillary-mucinous neoplasm ... 1.500 3.6e-02
Multiple myeloma 1.570 1.0e-04
non primary Sjogren syndrome sicca 1.400 1.9e-02
osteosarcoma 1.744 4.7e-04
ovarian cancer -2.100 2.3e-08
pediatric high grade glioma 1.200 2.3e-02
Waldenstrons macroglobulinemia 1.052 1.2e-02

Protein-protein Interaction (9)

Gene RIF (710)

AA Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPL      1 - 70
SYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYP     71 - 140
QGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL                      141 - 192
//

Text Mined References (909)

PMID Year Title