Property Summary

NCBI Gene PubMed Count 62
PubMed Score 39.44
PubTator Score 38.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy 1.138 3.4e-06
aldosterone-producing adenoma -1.030 2.7e-02
Breast cancer -1.200 2.1e-13
dermatomyositis 1.500 2.1e-04
diabetes mellitus -1.100 2.8e-03
glioblastoma 1.300 2.8e-03
group 3 medulloblastoma 1.400 5.7e-04
hepatocellular carcinoma -1.500 1.7e-03
lung cancer -1.800 1.3e-04
malignant mesothelioma 1.500 5.9e-07
medulloblastoma, large-cell 1.300 6.7e-06
Multiple myeloma 2.249 2.6e-04
osteosarcoma 1.378 3.9e-03
ovarian cancer -1.400 4.5e-05
primitive neuroectodermal tumor 1.200 1.8e-02
psoriasis 1.300 1.1e-04
Waldenstrons macroglobulinemia 1.548 6.6e-03

Gene RIF (28)

AA Sequence

MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRSRRSSRRHYTR      1 - 70
SRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSK     71 - 140
YGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGR    141 - 210
PTYGSSRRRDYYDRGYDRGYDDRDYYSRSYRGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRS    211 - 280
RSYSPRRY                                                                  281 - 288
//

Text Mined References (72)

PMID Year Title