Property Summary

NCBI Gene PubMed Count 60
Grant Count 11
R01 Count 4
Funding $953,340.18
PubMed Score 39.29
PubTator Score 38.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
hepatocellular carcinoma -1.500 0.002
Waldenstrons macroglobulinemia 1.599 0.009
Multiple myeloma 2.249 0.000
malignant mesothelioma 1.500 0.000
psoriasis 1.300 0.000
osteosarcoma -1.430 0.000
group 3 medulloblastoma 2.400 0.001
glioblastoma 1.300 0.003
medulloblastoma, large-cell 1.300 0.000
primitive neuroectodermal tumor 1.200 0.018
acute quadriplegic myopathy 1.138 0.000
lung cancer -1.800 0.000
diabetes mellitus -1.100 0.003
aldosterone-producing adenoma -1.030 0.027
Breast cancer -1.200 0.000
ovarian cancer 2.200 0.000
dermatomyositis 1.500 0.000

Gene RIF (30)

PMID Text
26298634 that TRA2beta promotes glioma cell growth and migration, and could be a candidate for molecular targeting during gene therapy treatments of glioma
26261585 Tra2beta was significantly upregulated in prostate carcinoma, and multivariate analysis confirmed Tra2beta as an independent prognostic factor.
26013829 SRPK1 is a regulator of Tra2beta1 splicing function and individual domains engage in considerable cross-talk, assuming novel functions with regard to RNA binding, splicing, and catalysis.
25970345 Overexpression of either Tra2alpha or Tra2beta results in a marked reduction in HIV-1 Gag/ Env expression.
25970345 HIV-1 Env synthesis is enhanced (slightly) by endogeneous levels of TRA2B; shRNA knockdown of TRA2B reduces Env synthesis slightly (~2 fold) in the HeLa rtTA HIVdletamls cell line (contains stably integrated, doxycycline (Dox) inducible HIV-1 provirus)
25970345 HIV-1 Env synthesis is enhanced (slightly) by endogeneous levels of TRA2B; shRNA knockdown of TRA2B reduces Env synthesis slightly (~2 fold) in the HeLa rtTA HIVdletamls cell line (contains stably integrated, doxycycline (Dox) inducible HIV-1 provirus)
25970345 Multiply spliced HIV-1 RNA is increased by TRA2B overexpression resulting in blocking of HIV-1 genomic RNA export
25970345 Multiply spliced HIV-1 RNA is increased by TRA2B overexpression resulting in blocking of HIV-1 genomic RNA export
25884434 Results showed that HNRNPG and HTRA2-BETA1 were specific antagonistic regulators of ERa exon7 splicing and increased HNRNPG levels were associated with improved clinical outcome of endometrial cancer through up-regulation of ERaD7 expression.
25416801 HIV-1 Env synthesis is enhanced (slightly) by endogeneous levels of TRA2B; shRNA knockdown of TRA2B reduces Env synthesis slightly (~2 fold) in the HeLa rtTA HIVdletamls cell line (contains stably integrated, doxycycline (Dox) inducible HIV-1 provirus)
More...

AA Sequence

MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRSRRSSRRHYTR      1 - 70
SRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSK     71 - 140
YGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGR    141 - 210
PTYGSSRRRDYYDRGYDRGYDDRDYYSRSYRGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRS    211 - 280
RSYSPRRY                                                                  281 - 288
//

Text Mined References (69)

PMID Year Title
26298634 2015 Knocking down the expression of TRA2? inhibits the proliferation and migration of human glioma cells.
26261585 2015 Prognostic value of transformer 2? expression in prostate cancer.
26013829 2015 Intra-domain Cross-talk Regulates Serine-arginine Protein Kinase 1-dependent Phosphorylation and Splicing Function of Transformer 2?1.
25970345 2015 Differential Effects of Tra2ß Isoforms on HIV-1 RNA Processing and Expression.
25884434 2015 HNRNP G and HTRA2-BETA1 regulate estrogen receptor alpha expression with potential impact on endometrial cancer.
25342468 2015 Transformer 2? and miR-204 regulate apoptosis through competitive binding to 3' UTR of BCL2 mRNA.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25208576 2014 Human Tra2 proteins jointly control a CHEK1 splicing switch among alternative and constitutive target exons.
24952301 2014 Transformer 2? (Tra2?/SFRS10) positively regulates the progression of NSCLC via promoting cell proliferation.
24865968 2014 HuR regulates alternative splicing of the TRA2? gene in human colon cancer cells under oxidative stress.
More...