Property Summary

Ligand Count 119
NCBI Gene PubMed Count 531
PubMed Score 981.35
PubTator Score 685.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Schizophrenia 1160
Disease Target Count Z-score Confidence
Cancer 2499 4.868 2.4

Expression

  Differential Expression (7)

Disease log2 FC p
invasive ductal carcinoma 1.400 1.5e-02
juvenile dermatomyositis 1.032 6.6e-12
medulloblastoma, large-cell -1.100 3.6e-04
osteosarcoma 1.283 1.6e-03
ovarian cancer -1.300 3.0e-04
psoriasis 2.800 2.4e-05
Rheumatoid arthritis 1.300 1.7e-03

Gene RIF (130)

AA Sequence

MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKA      1 - 70
EEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSV     71 - 140
SRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYV    141 - 210
TPVNRNV                                                                   211 - 217
//

Text Mined References (555)

PMID Year Title