Property Summary

NCBI Gene PubMed Count 517
Grant Count 409
R01 Count 303
Funding $24,926,719.57
PubMed Score 933.52
PubTator Score 685.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.002
psoriasis 2.800 0.000
osteosarcoma -1.429 0.002
medulloblastoma, large-cell -1.100 0.000
juvenile dermatomyositis 1.032 0.000
invasive ductal carcinoma 1.400 0.015
ovarian cancer 2.100 0.000

Synonym

Accession P62993 P29354 Q14450 Q63057 Q63059
Symbols ASH
Grb3-3
MST084
NCKAP2
MSTP084
EGFRBP-GRB2

Gene

PDB

2VWF   2W0Z   1AZE   1BM2   1BMB   1CJ1   1FHS   1FYR   1GCQ   1GFC   1GFD   1GHU   1GRI   1IO6   1JYQ   1JYR   1JYU   1QG1   1TZE   1X0N   1ZFP   2AOA   2AOB   2H46   2H5K   2HUW   2VVK   3C7I   3IMD   3IMJ   3IN7   3IN8   3KFJ   3MXC   3MXY   3N7Y   3N84   3N8M   3OV1   3OVE   3S8L   3S8N   3S8O   3WA4   4P9V   4P9Z   5CDW  

Gene RIF (124)

PMID Text
26511382 TGF-beta2 induces Grb2 to recruit PI3-K to TGF-RII that activates JNK/AP-1-signaling and augments invasiveness of Theileria-transformed macrophages.
26188370 Genetic variation near GRB2 on chromosome 17q25.1 is associated with sight-threatening diabetic retinopathy.
26103942 Only monomeric Grb2 is capable of upregulating MAP kinase signalling. The dimeric state is inhibitory to this process. The self-association/dissociation of Grb2 represents a switch that regulates MAP kinase activity and hence controls cancer progression.
26079855 findings show that regions outside of the consensus PxxPxR sites drive the high affinity association of GRB2 with SH3 domain ligands
25688510 In addition, GRB2 and UBC were found to be hub nodes in the differentially expressed subnetwork and may be used as potential biomarkers or targets for the diagnosis of bladder cancer.
25659534 down-regulated molecule growth factor receptor-bound protein 2 (GRB2) was a prominent node in fourteen cell proliferation-related sub-pathways.
25413232 The immunoglobulin tail tyrosine motif in the cytoplasmic segments of membrane-bound IgGs acts as the principle signal amplifier by incorporating a Grb2-Btk signaling.
25041730 C-SH3 of Grb2 mediates the interaction with mutant Htt and this interaction being stronger could replace Gab1, with mutant Htt becoming the preferred partner. This would have immense effect on downstream signaling events.
25031732 GRB2 was an independent factor in prognosis of esophageal squamous cell carcinoma patients
24939894 Knockdown of GRB2 suppressed LMTK3-induced CDC42 activation, blocked ITGA5 and ITGB1 expression promoted by the transcription factor serum response factor (SRF), and reduced invasive activity
More...

AA Sequence

MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKA      1 - 70
EEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSV     71 - 140
SRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYV    141 - 210
TPVNRNV                                                                   211 - 217
//

Text Mined References (540)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27059931 2016 Weak binding to E3 ubiquitin ligase c-Cbl increases EGFRvA protein stability.
26511382 2015 TGF-?2 induces Grb2 to recruit PI3-K to TGF-RII that activates JNK/AP-1-signaling and augments invasiveness of Theileria-transformed macrophages.
26188370 2015 Genome-wide association study for sight-threatening diabetic retinopathy reveals association with genetic variation near the GRB2 gene.
26103942 2015 Grb2 monomer-dimer equilibrium determines normal versus oncogenic function.
26079855 2015 Regions outside of conserved PxxPxR motifs drive the high affinity interaction of GRB2 with SH3 domain ligands.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25819436 2015 A single PXXP motif in the C-terminal region of srGAP3 mediates binding to multiple SH3 domains.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25688510 Dynamic expression changes between non-muscle-invasive bladder cancer and muscle-invasive bladder cancer.
More...