Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.02
PubTator Score 3.38

Knowledge Summary

Patent (193)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Renal oncocytoma 22 3.721 1.9

Expression

Synonym

Accession P62955 Q52LL8 Q8VBX3 Q8WXS6 Q9BXT1
Symbols

Gene

  TechDev Info (2)

Jing-Ruey Yeh gRNA validated for zebrafish model
Susumu Tomita Channel activity

AA Sequence

MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWRVCFFAGREKG      1 - 70
RCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFIL     71 - 140
SGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRYAEEEMY    141 - 210
RPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC         211 - 275
//

Text Mined References (7)

PMID Year Title
21172611 2010 Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins.
17652770 2007 Calcium channel gamma subunits: a functionally diverse protein family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11927536 2002 The novel product of a five-exon stargazin-related gene abolishes Ca(V)2.2 calcium channel expression.
11738816 2001 Calcium channel gamma subunits provide insights into the evolution of this gene family.
11170751 2001 A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family.