Property Summary

NCBI Gene PubMed Count 26
PubMed Score 35.05
PubTator Score 22.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (9)

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHC      1 - 70
SDSPLPESAHDPGVVGT                                                          71 - 87
//

Text Mined References (26)

PMID Year Title