Property Summary

NCBI Gene PubMed Count 25
PubMed Score 29.70
PubTator Score 22.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 9.19360390531954E-9
acute quadriplegic myopathy 1157 1.35816588684563E-8
ovarian cancer 8492 9.10127700208102E-6
interstitial cystitis 2299 1.04908088414928E-5
osteosarcoma 7933 8.01782420977406E-5
psoriasis 6685 1.14206439020761E-4
ductal carcinoma in situ 1745 1.8401657254649E-4
dermatomyositis 967 5.80946902639786E-4
medulloblastoma, large-cell 6234 5.84908704041312E-4
primitive neuroectodermal tumor 3031 0.00169391664807487
Multiple myeloma 1328 0.00354909835680126
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00598139808776893
atypical teratoid / rhabdoid tumor 4369 0.0103471861859116
primary pancreatic ductal adenocarcinoma 1271 0.017930599760332
pancreatic cancer 2300 0.0188651202135078
pituitary cancer 1972 0.0321379579691383
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.040416697172787
Disease Target Count Z-score Confidence
Urinary bladder cancer 34 3.932 2.0

Expression

Synonym

Accession P62952 A2A2K7 O60629 Q9D3B5
Symbols BC10

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (7)

PMID Text
25499081 Data show that the RNA-edited bladder cancer associated protein (BLCAP) gene may stably promote cell proliferation.
23049907 Immunoexpression analysis and prognostic value of BLCAP in breast cancer
19908260 observed a general decrease in BLCAP-editing level in astrocytomas, bladder cancer and colorectal cancer when compared with the related normal tissues
19783793 Data show that loss of BLCAP expression is associated with tumor progression.
18836209 Blcap is imprinted in mouse and human brain, but not in other mouse tissues.
17031575 BLCAP may play a role not only in regulating cell proliferation but also in coordinating apoptosis and cell cycle via a novel way independent of p53 and NF-kappaB.
16675915 might be a potential tumor suppressor gene in cervical carcinoma.

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHC      1 - 70
SDSPLPESAHDPGVVGT                                                          71 - 87
//

Text Mined References (25)

PMID Year Title
26986503 2016 BLCAP arrests G?/S checkpoint and induces apoptosis through downregulation of pRb1 in HeLa cells.
26186239 2015 Placental expression profile of imprinted genes impacts birth weight.
25499081 2015 RNA over-editing of BLCAP contributes to hepatocarcinogenesis identified by whole-genome and transcriptome sequencing.
25416956 2014 A proteome-scale map of the human interactome network.
23049907 2012 Immunoexpression analysis and prognostic value of BLCAP in breast cancer.
21844121 2011 BLCAP induces apoptosis in human Ewing's sarcoma cells.
21217774 2011 RAC3 is a pro-migratory co-activator of ER?.
19908260 2010 Human BLCAP transcript: new editing events in normal and cancerous tissues.
19783793 2010 Bladder cancer-associated protein, a potential prognostic biomarker in human bladder cancer.
18836209 2009 Transcript- and tissue-specific imprinting of a tumour suppressor gene.
More...