Property Summary

NCBI Gene PubMed Count 25
Grant Count 5
Funding $40,945
PubMed Score 29.70
PubTator Score 22.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
25499081 Data show that the RNA-edited bladder cancer associated protein (BLCAP) gene may stably promote cell proliferation.
23049907 Immunoexpression analysis and prognostic value of BLCAP in breast cancer
19908260 observed a general decrease in BLCAP-editing level in astrocytomas, bladder cancer and colorectal cancer when compared with the related normal tissues
19783793 Data show that loss of BLCAP expression is associated with tumor progression.
18836209 Blcap is imprinted in mouse and human brain, but not in other mouse tissues.
17031575 BLCAP may play a role not only in regulating cell proliferation but also in coordinating apoptosis and cell cycle via a novel way independent of p53 and NF-kappaB.
16675915 might be a potential tumor suppressor gene in cervical carcinoma.

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHC      1 - 70
SDSPLPESAHDPGVVGT                                                          71 - 87
//

Text Mined References (25)

PMID Year Title
26986503 2016 BLCAP arrests G?/S checkpoint and induces apoptosis through downregulation of pRb1 in HeLa cells.
26186239 2015 Placental expression profile of imprinted genes impacts birth weight.
25499081 2015 RNA over-editing of BLCAP contributes to hepatocarcinogenesis identified by whole-genome and transcriptome sequencing.
25416956 2014 A proteome-scale map of the human interactome network.
23049907 2012 Immunoexpression analysis and prognostic value of BLCAP in breast cancer.
21844121 2011 BLCAP induces apoptosis in human Ewing's sarcoma cells.
21217774 2011 RAC3 is a pro-migratory co-activator of ER?.
19908260 2010 Human BLCAP transcript: new editing events in normal and cancerous tissues.
19783793 2010 Bladder cancer-associated protein, a potential prognostic biomarker in human bladder cancer.
18836209 2009 Transcript- and tissue-specific imprinting of a tumour suppressor gene.
More...