Property Summary

NCBI Gene PubMed Count 99
Grant Count 231
R01 Count 179
Funding $20,930,556.8
PubMed Score 370.59
PubTator Score 173.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
astrocytic glioma -1.200 0.017
psoriasis 1.100 0.007
osteosarcoma 3.329 0.000
glioblastoma 1.200 0.010
tuberculosis 1.400 0.000
cystic fibrosis 1.100 0.001
pediatric high grade glioma 1.100 0.004
group 3 medulloblastoma -1.100 0.031
Pick disease -1.100 0.000

Synonym

Accession P62942 D3DVW6 P20071 Q4VC47 Q6FGD9 Q6LEU3 Q9H103 Q9H566 PPIase FKBP1A
Symbols FKBP1
PKC12
PKCI2
FKBP12
PPIASE
FKBP-12
FKBP-1A

Gene

PANTHER Protein Class (1)

PDB

1A7X   1B6C   1BKF   1BL4   1D6O   1D7H   1D7I   1D7J   1EYM   1F40   1FAP   1FKB   1FKD   1FKF   1FKG   1FKH   1FKI   1FKJ   1FKR   1FKS   1FKT   1J4H   1J4I   1J4R   1NSG   1QPF   1QPL   2DG3   2DG4   2DG9   2FAP   2FKE   2PPN   2PPO   2PPP   2RSE   3FAP   3H9R   3MDY   4DH0   4FAP   4IPX   4N19   4ODP   4ODQ   4ODR  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
608 other 51 / 0 / 3768 NMR Based Screening Assay for FKBP12

Gene RIF (37)

PMID Text
26450664 Findings indicate that mutant huntingtin (mHTT) aggregates can be transformed into benign species by isomerase FKBP12.
26009186 How phosphorylation of RyR affects channel activity and whether proteins such as the FK-506 binding proteins (FKBP12 and FKBP12.6) are involved in heart failure
26009182 RyRs have been identified as important targets of FKBP12 and FKBP12.6, members of the immunophilin family
25659145 Ultra-fast Shape Recognition with Atom Types--the discovery of novel bioactive small molecular scaffolds for FKBP12 and 11betaHSD1.
25615537 Selectivity within the FKBP family, in particular selective inhibition of FKBP12 or FKBP51, is possible. FKBP51 is a pharmacologically tractable target for stress-related disorders.
24607931 peptidyl prolyl cis-trans isomerase activity of FKBP12 probably plays a role in inhibition of receptor phosphorylation.
24598733 Enhanced plasticity in the active site of FKBP12.6 is likely to contribute to marked attenuation in the spatial extent of the residues that exhibit doubling of their amide resonances compared with those of the homologous FKBP12.
24559985 FKBP12 inhibits RyR1 and FKBP12 E31Q/D32N/W59F mutant activates RyR1 in vitro.
24499793 FKBP12 regulates the localization and processing of amyloid precursor protein in human cell lines.
24405377 the structural basis of the slow resonance doubling transition of FKBP12 and the more rapid conformational linebroadening transition in the 80's loop to gain insight into how these effects are propagated through the protein structure
More...

AA Sequence

MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVG      1 - 70
QRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE                                     71 - 108
//

Text Mined References (101)

PMID Year Title
26450664 2015 Conformational switch of polyglutamine-expanded huntingtin into benign aggregates leads to neuroprotective effect.
26009186 2015 The ryanodine receptor provides high throughput Ca2+-release but is precisely regulated by networks of associated proteins: a focus on proteins relevant to phosphorylation.
26009182 2015 Bcl-2 and FKBP12 bind to IP3 and ryanodine receptors at overlapping sites: the complexity of protein-protein interactions for channel regulation.
25659145 2015 UFSRAT: Ultra-fast Shape Recognition with Atom Types--the discovery of novel bioactive small molecular scaffolds for FKBP12 and 11?HSD1.
25615537 2015 FKBPs and their role in neuronal signaling.
25416956 2014 A proteome-scale map of the human interactome network.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24607931 2014 Role of FK506 binding protein 12 in morphine-induced ?-opioid receptor internalization and desensitization.
24598733 2014 Crystal structure and conformational flexibility of the unligated FK506-binding protein FKBP12.6.
24559985 2014 FKBP12.6 activates RyR1: investigating the amino acid residues critical for channel modulation.
More...