Property Summary

Ligand Count 343
NCBI Gene PubMed Count 105
PubMed Score 382.79
PubTator Score 173.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.200 1.7e-02
cystic fibrosis 1.100 1.0e-03
glioblastoma 1.100 3.8e-03
group 3 medulloblastoma -1.100 3.1e-02
malignant mesothelioma -1.300 4.5e-06
osteosarcoma -1.247 5.0e-03
pediatric high grade glioma 1.100 4.0e-03
Pick disease -1.100 1.2e-04
psoriasis 1.100 7.0e-03
tuberculosis 1.400 7.8e-06

Synonym

Accession P62942 D3DVW6 P20071 Q4VC47 Q6FGD9 Q6LEU3 Q9H103 Q9H566 PPIase FKBP1A
Symbols FKBP1
PKC12
PKCI2
FKBP12
PPIASE
FKBP-12
FKBP-1A

Gene

PANTHER Protein Class (1)

PDB

1A7X   1B6C   1BKF   1BL4   1D6O   1D7H   1D7I   1D7J   1EYM   1F40   1FAP   1FKB   1FKD   1FKF   1FKG   1FKH   1FKI   1FKJ   1FKR   1FKS   1FKT   1J4H   1J4I   1J4R   1NSG   1QPF   1QPL   2DG3   2DG4   2DG9   2FAP   2FKE   2ND5   2PPN   2PPO   2PPP   2RSE   3FAP   3H9R   3MDY   4DH0   4FAP   4IPX   4N19   4ODP   4ODQ   4ODR   5I7P   5I7Q  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (42)

AA Sequence

MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVG      1 - 70
QRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE                                     71 - 108
//

Text Mined References (107)

PMID Year Title