Property Summary

NCBI Gene PubMed Count 254
Grant Count 179
R01 Count 128
Funding $21,059,532.49
PubMed Score 833.52
PubTator Score 518.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession P62937 A8K220 P05092 Q3KQW3 Q567Q0 Q6IBU5 Q96IX3 Q9BRU4 Q9BTY9 Q9UC61 PPIase A
Symbols CYPA
CYPH
HEL-S-69p

Gene

PANTHER Protein Class (1)

PDB

1M63   1MF8   1AK4   1AWQ   1AWR   1AWS   1AWT   1AWU   1AWV   1BCK   1CWA   1CWB   1CWC   1CWF   1CWH   1CWI   1CWJ   1CWK   1CWL   1CWM   1CWO   1FGL   1M9C   1M9D   1M9E   1M9F   1M9X   1M9Y   1MIK   1NMK   1OCA   1RMH   1VBS   1VBT   1W8L   1W8M   1W8V   1YND   1ZKF   2ALF   2CPL   2CYH   2MS4   2MZU   2N0T   2RMA   2RMB   2X25   2X2A   2X2C   2X2D   2XGY   3CYH   3CYS   3K0M   3K0N   3K0O   3K0P   3K0Q   3K0R   3ODI   3ODL   3RDD   4CYH   4IPZ   4N1M   4N1N   4N1O   4N1P   4N1Q   4N1R   4N1S   4YUG   4YUH   4YUI   4YUJ   4YUK   4YUL   4YUM   4YUN   4YUO   4YUP   5CYH   5F66   5FJB   5KUL   5KUN   5KUO   5KUQ   5KUR   5KUS   5KUU   5KUV   5KUW   5KUZ   5KV0   5KV1   5KV2   5KV3   5KV4   5KV5   5KV6   5KV7  

Gene RIF (440)

PMID Text
26833980 the states of phosphorylation of Cyp A by Akt can influence the progress of the cell cycle in multiple myeloma.
26792730 CsA and FK506 might interfere with selected effector T cell functions via a CrkII-, but not CrkI-dependent mechanisms.
26702934 results indicate that the PPIA SNP rs6850: A > G is associated with increased risk for elevated plasma levels of cyclophilin A and coronary artery disease in patients with and without type 2 diabetes
26414211 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
26414211 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
26318518 The present knowledge on the role of cyclophilin A during coronavirus replication is summarized (Review)
26281011 review of PPIA polymorphisms and what is known about their impact on the replication cycle and course of disease for different viral infections
26095851 Cyclophilin A regulates JNK/p38-MAPK signaling through its physical interaction with ASK1.
26084004 Enhanced platelet-bound CyPA is associated with hypertension and hypercholesterolemia in stable coronary artery disease patients. In patients with acute myocardial infarction platelet-bound CyPA is significantly decreased.
26008617 These results indicate a special function mode for CypA of playing more important roles in the early stage of gastric tumorigenesis.
More...

AA Sequence

MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRH      1 - 70
NGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVE     71 - 140
AMERFGSRNGKTSKKITIADCGQLE                                                 141 - 165
//

Text Mined References (268)

PMID Year Title
26833980 2015 Cyclophilin A as a downstream effector of PI3K/Akt signalling pathway in multiple myeloma cells.
26792730 2016 In vivo regulation of human CrkII by cyclophilin A and FK506-binding protein.
26702934 2016 PPIA rs6850: A > G single-nucleotide polymorphism is associated with raised plasma cyclophilin A levels in patients with coronary artery disease.
26318518 2015 Genetic deficiency and polymorphisms of cyclophilin A reveal its essential role for Human Coronavirus 229E replication.
26281011 2015 Cyclophilin polymorphism and virus infection.
26095851 2015 Cyclophilin A regulates JNK/p38-MAPK signaling through its physical interaction with ASK1.
26084004 2016 Platelet-bound cyclophilin A in patients with stable coronary artery disease and acute myocardial infarction.
26008617 2015 Cyclophilin A Enhances Cell Proliferation and Xenografted Tumor Growth of Early Gastric Cancer.
26005854 2015 The Cyclophilin A-CD147 complex promotes the proliferation and homing of multiple myeloma cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
More...