Property Summary

Ligand Count 104
NCBI Gene PubMed Count 269
PubMed Score 870.71
PubTator Score 518.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.896 6.0e-08
Breast cancer 2.000 2.9e-02
intraductal papillary-mucinous adenoma (... 1.300 3.3e-03
intraductal papillary-mucinous carcinoma... 1.800 8.7e-03
juvenile dermatomyositis 1.037 1.2e-10
osteosarcoma 1.419 1.1e-02
ovarian cancer -1.500 4.4e-12

Synonym

Accession P62937 A8K220 P05092 Q3KQW3 Q567Q0 Q6IBU5 Q96IX3 Q9BRU4 Q9BTY9 Q9UC61 PPIase A
Symbols CYPA
CYPH
HEL-S-69p

Gene

PDB

1M63   1MF8   1AK4   1AWQ   1AWR   1AWS   1AWT   1AWU   1AWV   1BCK   1CWA   1CWB   1CWC   1CWF   1CWH   1CWI   1CWJ   1CWK   1CWL   1CWM   1CWO   1FGL   1M9C   1M9D   1M9E   1M9F   1M9X   1M9Y   1MIK   1NMK   1OCA   1RMH   1VBS   1VBT   1W8L   1W8M   1W8V   1YND   1ZKF   2ALF   2CPL   2CYH   2MS4   2MZU   2N0T   2RMA   2RMB   2X25   2X2A   2X2C   2X2D   2XGY   3CYH   3CYS   3K0M   3K0N   3K0O   3K0P   3K0Q   3K0R   3ODI   3ODL   3RDD   4CYH   4IPZ   4N1M   4N1N   4N1O   4N1P   4N1Q   4N1R   4N1S   4YUG   4YUH   4YUI   4YUJ   4YUK   4YUL   4YUM   4YUN   4YUO   4YUP   5CYH   5F66   5FJB   5KUL   5KUN   5KUO   5KUQ   5KUR   5KUS   5KUU   5KUV   5KUW   5KUZ   5KV0   5KV1   5KV2   5KV3   5KV4   5KV5   5KV6   5KV7   5LUD   5NOQ   5NOR   5NOS   5NOT   5NOU   5NOV   5NOW   5NOX   5NOY   5NOZ   5T9U   5T9W   5T9Z   5TA2   5TA4  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (305)

AA Sequence

MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRH      1 - 70
NGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVE     71 - 140
AMERFGSRNGKTSKKITIADCGQLE                                                 141 - 165
//

Text Mined References (285)

PMID Year Title