Property Summary

NCBI Gene PubMed Count 65
PubMed Score 152.44
PubTator Score 72.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Anemia, Diamond-Blackfan 15
Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 1.77376783631535E-5
ovarian cancer 8492 4.83097009502451E-5
diabetes mellitus 1663 0.00110107034418028
Multiple myeloma 1328 0.00178577932688882
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0046528492398288
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0135688137269702
acute myeloid leukemia 785 0.0152864750156592
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0243254913387752
mucosa-associated lymphoid tissue lymphoma 480 0.0363362401662822
Waldenstrons macroglobulinemia 765 0.0390123396839026
Disease Target Count Z-score Confidence
Anemia 252 4.461 2.2

Expression

Synonym

Accession P62913 P25121 P39026 Q8TDH2 Q9Y674
Symbols L11
DBA7
GIG34

Gene

PDB

4UG0   4V6X   5AJ0   4XXB  

  Ortholog (13)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA EggNOG
S.cerevisiae OMA Inparanoid

Gene RIF (35)

PMID Text
26606907 Data suggest 5S ribosomal RNA is a direct target of miR-150 and miR-383 in esophageal squamous cell carcinoma (ESCC); overexpression of miR-150 and miR-383 inhibits ESCC cell proliferation in vitro and in vivo and intensifies RPL11/c-Myc interaction.
26362536 HIV-1 Gag interacts with RPL11 as demonstrated by proximity dependent biotinylation proteomics
25829192 Data indicate that ribosomal protein L11 (RPL11)-expressing cells proliferated more rapidly than the ribosomal protein L11 (RPL11)-expressing cells.
25544755 Data indicate that ribosomal protein (L11) promotes the recruitment of microRNA-130a (miR-130a) to oncoprotein c-Myc in response to UV irradiation treatment.
25301064 Ribosomal proteins L11 and L5 activate TAp73 by overcoming MDM2 inhibition.
24463277 levels of branched-chain aminotransferase-1 (BCAT1) transcripts are significantly decreased on the polysomes of both RPS19 and RPL11 cells and that translation of BCAT1 protein is especially impaired in cells with small RP gene mutations
24141778 Findings uncover a mechanism by which RPL5 and RPL11 can co-operatively suppress c-Myc expression, allowing a tightly controlled ribosome biogenesis in cells.
24061479 Unlike other tumor suppressors, RPL5 and RPL11 play essential roles in normal cell proliferation.
24045667 Findings suggest that PICT1 has a crucial role in gastric cancer progression by regulating the MDM2-TP53 pathway through RPL11.
23874603 HIV-1 Gag interacts with RPL11 as demonstrated by proximity dependent biotinylation proteomics
More...

AA Sequence

MAQDQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKIAV      1 - 70
HCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFS     71 - 140
IADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIILPGK                                    141 - 178
//

Text Mined References (73)

PMID Year Title
26606907 2015 Down-regulation of 5S rRNA by miR-150 and miR-383 enhances c-Myc-rpL11 interaction and inhibits proliferation of esophageal squamous carcinoma cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25829192 2015 Ribosomal protein L11- and retinol dehydrogenase 11-induced erythroid proliferation without erythropoietin in UT-7/Epo erythroleukemic cells.
25544755 2015 MicroRNA-130a associates with ribosomal protein L11 to suppress c-Myc expression in response to UV irradiation.
25416956 2014 A proteome-scale map of the human interactome network.
25301064 2015 Ribosomal proteins L11 and L5 activate TAp73 by overcoming MDM2 inhibition.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24463277 2014 Translation of branched-chain aminotransferase-1 transcripts is impaired in cells haploinsufficient for ribosomal protein genes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24141778 2014 Ribosomal proteins L5 and L11 co-operatively inactivate c-Myc via RNA-induced silencing complex.
More...