Property Summary

NCBI Gene PubMed Count 71
PubMed Score 158.95
PubTator Score 72.66

Knowledge Summary

Patent

No data available

Expression

Gene RIF (36)

AA Sequence

MAQDQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKIAV      1 - 70
HCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFS     71 - 140
IADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIILPGK                                    141 - 178
//

Text Mined References (81)

PMID Year Title