Property Summary

NCBI Gene PubMed Count 20
PubMed Score 130.67
PubTator Score 92.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Spondylolysis 9 3.548 1.8
Tyrosinemia type I 3 3.082 1.5

Expression

Synonym

Accession P62910 B2R4Q3 P02433
Symbols L32
PP9932

Gene

PDB

4UG0   4V6X   5AJ0  

Gene RIF (1)

PMID Text
22174317 HIV-1 Rev interacting protein, ribosomal protein L32 (RPL32), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MAALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHML      1 - 70
PSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSEENE          71 - 135
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25712143 2015 An abnormality in glucocorticoid receptor expression differentiates steroid responders from nonresponders in keloid disease.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17054774 2006 Expression of full-length p53 and its isoform Deltap53 in breast carcinomas in relation to mutation status and clinical parameters.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
More...