Property Summary

NCBI Gene PubMed Count 20
PubMed Score 143.34
PubTator Score 92.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Spondylolysis 14 3.516 1.8
Tyrosinemia type I 4 3.017 1.5

Expression

Gene RIF (1)

AA Sequence

MAALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHML      1 - 70
PSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSEENE          71 - 135
//

Text Mined References (27)

PMID Year Title