Property Summary

NCBI Gene PubMed Count 25
PubMed Score 41.82
PubTator Score 11.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Adenocarcinoma of lung 142 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Disease Target Count P-value
diabetes mellitus 1728 1.3e-03

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.800 1.3e-03

Gene RIF (3)

AA Sequence

MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGD      1 - 70
QQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTH     71 - 140
NENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTM    141 - 210
GKPQRLY                                                                   211 - 217
//

Text Mined References (34)

PMID Year Title