Property Summary

NCBI Gene PubMed Count 29
PubMed Score 19.48
PubTator Score 33.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.100 4.7e-06
Breast cancer -1.700 1.6e-10
cystic fibrosis -1.500 1.1e-04
group 3 medulloblastoma 1.400 1.1e-02
intraductal papillary-mucinous adenoma (... -1.700 3.9e-02
intraductal papillary-mucinous carcinoma... -1.800 3.2e-02
intraductal papillary-mucinous neoplasm ... -2.900 2.7e-03
invasive ductal carcinoma -1.359 2.3e-03
lung cancer 1.100 4.6e-03
malignant mesothelioma -1.700 1.6e-07
medulloblastoma, large-cell 1.400 1.2e-04
Multiple myeloma 1.146 8.8e-04
osteosarcoma 1.513 4.7e-03
ovarian cancer -1.300 3.1e-02
pituitary cancer 1.100 7.5e-03
primitive neuroectodermal tumor 1.600 1.0e-03
psoriasis -1.200 1.2e-05

Gene RIF (2)

AA Sequence

MAPAKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNK      1 - 70
AVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVDEN                    71 - 125
//

Text Mined References (39)

PMID Year Title