Property Summary

NCBI Gene PubMed Count 29
Grant Count 8
R01 Count 7
Funding $2,287,372
PubMed Score 17.85
PubTator Score 33.37

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
25285958 protein levels of the tumor suppressor p53 and its targets, p21 and MDM2, were increased in LNCaP and bicalutamide-resistant LNCaP cells treated with RPL31 siRNA.
25042156 gene discovery in DBA, resulting in the identification of RPL31 as a novel DBA gene.

AA Sequence

MAPAKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNK      1 - 70
AVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVDEN                    71 - 125
//

Text Mined References (38)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25285958 2014 Short hairpin RNA library-based functional screening identified ribosomal protein L31 that modulates prostate cancer cell growth via p53 pathway.
25042156 2014 Exploiting pre-rRNA processing in Diamond Blackfan anemia gene discovery and diagnosis.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
More...