Property Summary

NCBI Gene PubMed Count 29
PubMed Score 17.85
PubTator Score 33.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Mammary Neoplasms 410
Disease Target Count P-value
Breast cancer 3099 2.86135390130955E-13
malignant mesothelioma 3163 1.94343047220721E-8
osteosarcoma 7933 1.99387708314423E-7
atypical teratoid / rhabdoid tumor 4369 4.73745954646607E-6
group 3 medulloblastoma 2254 1.63474436411517E-5
medulloblastoma, large-cell 6234 1.65775094500737E-5
psoriasis 6685 8.3863116427973E-5
cystic fibrosis 1670 1.08567349688955E-4
Multiple myeloma 1328 8.83052625843058E-4
primitive neuroectodermal tumor 3031 0.0010357643082138
invasive ductal carcinoma 2950 0.00231971766361371
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00268317691809005
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00367798840859349
pituitary cancer 1972 0.00747902797699289
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0228744382318706
ovarian cancer 8492 0.030857756401838
lung cancer 4473 0.042606318598394
Disease Target Count Z-score Confidence
Chancroid 8 3.998 2.0

Expression

Synonym

Accession P62899 B7Z4K2 D3DVJ4 P12947 Q53SQ5 Q6IRZ0 Q6LBJ6
Symbols L31

Gene

PDB

4UG0   4V6X   5AJ0  

  Ortholog (17)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Rat OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae OMA EggNOG
S.cerevisiae OMA Inparanoid

Gene RIF (2)

PMID Text
25285958 protein levels of the tumor suppressor p53 and its targets, p21 and MDM2, were increased in LNCaP and bicalutamide-resistant LNCaP cells treated with RPL31 siRNA.
25042156 gene discovery in DBA, resulting in the identification of RPL31 as a novel DBA gene.

AA Sequence

MAPAKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNK      1 - 70
AVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVDEN                    71 - 125
//

Text Mined References (38)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25285958 2014 Short hairpin RNA library-based functional screening identified ribosomal protein L31 that modulates prostate cancer cell growth via p53 pathway.
25042156 2014 Exploiting pre-rRNA processing in Diamond Blackfan anemia gene discovery and diagnosis.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
More...