Property Summary

NCBI Gene PubMed Count 25
Grant Count 16
R01 Count 11
Funding $2,968,744.42
PubMed Score 35.09
PubTator Score 28.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.059 0.000
lung cancer -4.000 0.042
diabetes mellitus 2.100 0.001

Gene RIF (4)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human 60S ribosomal protein L30 (RPL30) at amino acid residues 92-93 by the HIV-1 protease
22139155 crystal of L30e diffracted to 1.6 A degrees resolution
20554519 Knockdown of L29 or L30 enhanced the interaction of MDM2 with L11 and L5 and markedly inhibited MDM2-mediated p53 ubiquitination, suggesting that direct perturbation of 60 S ribosomal biogenesis activates p53 via L11- and L5-mediated MDM2 suppression.
16968546 Gain of 8q-mapped RPL30 gene is associated with adverse outcome in Medulloblastoma.

AA Sequence

MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTG      1 - 70
VHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGEK                              71 - 115
//

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22139155 2011 Crystallization and preliminary X-ray structure analysis of human ribosomal protein L30e.
More...