Property Summary

NCBI Gene PubMed Count 26
PubMed Score 36.55
PubTator Score 28.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Multiple myeloma 1332 1.3e-04
lung cancer 4740 1.1e-03
diabetes mellitus 1728 1.4e-03

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.600 1.4e-03
lung cancer 1.300 1.1e-03
Multiple myeloma 1.059 1.3e-04

Gene RIF (4)

AA Sequence

MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTG      1 - 70
VHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGEK                              71 - 115
//

Text Mined References (38)

PMID Year Title