Property Summary

NCBI Gene PubMed Count 46
PubMed Score 2.98
PubTator Score 4.15

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.381 0.000
psoriasis 3.100 0.000
osteosarcoma 1.025 0.000
glioblastoma 1.200 0.013
ovarian cancer 2.200 0.000

Synonym

Accession P62879 B3KPU1 P11016 P54312
Symbols

Gene

Gene RIF (6)

PMID Text
25485910 GNB1 and GNB2 alterations confer transformed and resistance phenotypes across a range of human tumors and may be targetable with inhibitors of G protein signaling.
23043599 MIF and GNbeta2 interacted with influenza A H1N1 virus PB1-F2 protein.
22917497 Results indicate that G protein beta2 (Gbeta2) is required for starvation-induced NF-kappaB activation and constitutive NF-kappaB activity.
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
16973746 Recombinant Gbetagamma subunits were used to establish that the Gbeta(2)gamma(2) dimer can selectively reconstitute the inhibition of alpha(1H) channels in isolated membrane patches.
15955845 We conclude that the Gbetagamma complex interacts with the GR and suppresses its transcriptional activity by associating with the transcriptional complex formed on GR-responsive promoters.

AA Sequence

MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLL      1 - 70
VSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELP     71 - 140
GHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKL    141 - 210
WDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSR    211 - 280
SGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN              281 - 340
//

Text Mined References (51)

PMID Year Title
26900580 2016 Pathogenic mechanism of recurrent mutations of SCN8A in epileptic encephalopathy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25485910 2015 Mutations in G protein ? subunits promote transformation and kinase inhibitor resistance.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
23043599 2012 Identification of cellular proteins interacting with influenza A virus PB1-F2 protein.
22917497 2012 Serum starvation activates NF-?B through G protein ?2 subunit-mediated signal.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
More...