Property Summary

NCBI Gene PubMed Count 47
PubMed Score 3.15
PubTator Score 4.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6514 6.9e-06
ovarian cancer 8297 7.4e-06
Multiple myeloma 1296 1.2e-04
osteosarcoma 7766 2.0e-04
glioblastoma 5635 1.3e-02

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.200 1.3e-02
Multiple myeloma 1.381 1.2e-04
osteosarcoma 1.025 2.0e-04
ovarian cancer 2.200 7.4e-06
psoriasis 3.100 6.9e-06

Gene RIF (7)

AA Sequence

MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLL      1 - 70
VSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELP     71 - 140
GHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKL    141 - 210
WDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSR    211 - 280
SGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN              281 - 340
//

Text Mined References (52)

PMID Year Title