Property Summary

NCBI Gene PubMed Count 100
Grant Count 56
R01 Count 48
Funding $2,765,654.48
PubMed Score 67.18
PubTator Score 96.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytoma -1.100 0.003
acute myeloid leukemia -1.300 0.031
ovarian cancer 2.100 0.000

Synonym

Accession P62877 B2RDY1 Q8N6Z8 Q9D1S2 Q9WUK9 Q9Y254
Symbols ROC1
RNF75
BA554C12.1

Gene

PANTHER Protein Class (2)

PDB

2HYE   1LDJ   1LDK   1U6G   3RTR   4F52   4P5O   3DPL   3DQV   2LGV  

Gene RIF (47)

PMID Text
26742010 ROC1 has an important role in the malignant progression of bladder transitional cell carcinoma via the mTOR/DEPTOR pathway.
26632597 Nedd8(Q40E) cannot induce the same structural effect on Cul1-Rbx1 as wild-type Nedd8.
26540345 Data show that melanoma antigen, family C, 2 protein (MAGE-C2) binds with RING-box protein 1 (Rbx1) and Cullin 1, and regulates cyclin E stability in melanoma cells.
25981045 HIV-1 complexes with RBX1 (RBX2)
25918018 This work sheds new light on the roles of NEDD8 lysines on neddylation cascades and provides a dominant negative mutant for the study of neddylation and its biological functions.
25912140 These findings indicate that Rbx1 and Rbx2 can both activate Cul5-Vif E3 ligase in vitro, but they may undergo a more delicate selection mechanism in vivo.
25912140 HIV-1 complexes with RBX1 (RBX2)
25912140 HIV-1 complexes with RBX1 (RBX2)
25912140 HIV-1 complexes with RBX1 (RBX2)
25423367 eEF1A1 may mediate SAMHD1 turnover by targeting it to the proteosome for degradation through association with Cullin4A and Rbx1.
More...

AA Sequence

MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTV      1 - 70
AWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH                                     71 - 108
//

Text Mined References (115)

PMID Year Title
27565346 2016 Two Distinct Types of E3 Ligases Work in Unison to Regulate Substrate Ubiquitylation.
26742010 2016 Regulator of cullins-1 expression knockdown suppresses the malignant progression of muscle-invasive transitional cell carcinoma by regulating mTOR/DEPTOR pathway.
26632597 2015 Gln40 deamidation blocks structural reconfiguration and activation of SCF ubiquitin ligase complex by Nedd8.
26540345 2015 Cancer-testis antigen MAGE-C2 binds Rbx1 and inhibits ubiquitin ligase-mediated turnover of cyclin E.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25918018 2015 A lysine-to-arginine mutation on NEDD8 markedly reduces the activity of cullin RING E3 ligase through the impairment of neddylation cascades.
25912140 2015 Both Rbx1 and Rbx2 exhibit a functional role in the HIV-1 Vif-Cullin5 E3 ligase complex in vitro.
25585578 2015 FBH1 influences DNA replication fork stability and homologous recombination through ubiquitylation of RAD51.
25423367 2015 The eukaryotic elongation factor eEF1A1 interacts with SAMHD1.
25412959 2015 miR-194 targets RBX1 gene to modulate proliferation and migration of gastric cancer cells.
More...