Property Summary

NCBI Gene PubMed Count 81
PubMed Score 13.83
PubTator Score 4.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 6.8e-05
Multiple myeloma 1332 4.3e-04
Disease Target Count Z-score Confidence
Hereditary spherocytosis type 5 12 3.673 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.380 4.3e-04
ovarian cancer -1.400 6.8e-05

Gene RIF (77)

AA Sequence

MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK         1 - 67
//

Text Mined References (84)

PMID Year Title