Property Summary

NCBI Gene PubMed Count 92
Grant Count 8
R01 Count 5
Funding $687,602.71
PubMed Score 18.15
PubTator Score 9.57

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (33)

PMID Text
25675501 PhLP1 binding stabilizes the Gbeta fold, disrupting interactions with CCT and releasing a PhLP1-Gbeta dimer for assembly with Ggamma.
25485910 GNB1 and GNB2 alterations confer transformed and resistance phenotypes across a range of human tumors and may be targetable with inhibitors of G protein signaling.
24462769 Data indicate that endogenous mTOR interacts with Gbetagamma.
23954591 During corticogenesis, a cilium-transduced, noncanonical IGF-1R-Gbetagamma-phospho(T94)Tctex-1 signaling pathway promotes the proliferation of neural progenitors through modulation of ciliary resorption and G1 length.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of guanine nucleotide binding protein, beta polypeptide 1 (GNB1) expression by HIV-1 Vpr in Vpr transduced macrophages
23603342 GNB1 plays an important role in the mTOR-related anti-apoptosis pathway and can potentially be targeted in the treatment of human breast cancer.
23326349 Findings suggest a wide-ranging mechanism by which direct interaction of Gbetagamma with specific chromatin bound transcription factors regulates functional gene networks in response to GPCR activation in cells including the angiotensin II type 1 receptor.
23171003 This study provided evidence that GNB1 gene polymorphisms are related to rapid virological response in HCV-1 and HCV-2 infected patients. GNB1 may play an important role in activating the antiviral response prior to treatment.
23166591 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of guanine nucleotide binding protein, beta polypeptide 1 (GNB1) expression by HIV-1 Vpr in Vpr transduced macrophages
22065575 WDR26 is a novel Gbetagamma-binding protein that is required for the efficacy of Gbetagamma signaling and leukocyte migration
More...

AA Sequence

MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLL      1 - 70
VSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELA     71 - 140
GHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKL    141 - 210
WDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSK    211 - 280
SGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN              281 - 340
//

Text Mined References (102)

PMID Year Title
27108799 2016 Germline De Novo Mutations in GNB1 Cause Severe Neurodevelopmental Disability, Hypotonia, and Seizures.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25675501 2015 Structures of the G?-CCT and PhLP1-G?-CCT complexes reveal a mechanism for G-protein ?-subunit folding and G?? dimer assembly.
25485910 2015 Mutations in G protein ? subunits promote transformation and kinase inhibitor resistance.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24462769 2014 G?? interacts with mTOR and promotes its activation.
23954591 2013 IGF-1 activates a cilium-localized noncanonical G?? signaling pathway that regulates cell-cycle progression.
23868983 2013 Selection of Phototransduction Genes in Homo sapiens.
23603342 Guanine nucleotide binding protein ? 1: a novel transduction protein with a possible role in human breast cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...