Property Summary

NCBI Gene PubMed Count 35
PubMed Score 34.49
PubTator Score 32.94

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P62854 P02383 P70394 Q06722 Q3MHD8 Q6IRY4
Symbols S26
DBA10

Gene

PDB

4UG0   4V6X   5AJ0   5A2Q   5FLX  

 GWAS Trait (1)

Gene RIF (7)

PMID Text
23728348 RPS26 acts distinctively in different scenarios of p53 activation.
22689679 High frequency of RPS26 gene deletion is associated with Italian Diamond-Blackfan anemia.
22045982 Studies identified deletions at known Diamond-Blackfan anemia (DBA)-related ribosomal protein gene loci in 17% (9 of 51) of patients without an identifiable mutation, including RPS19, RPS17, RPS26, and RPL35A.
21414820 the Czech Diamond-Blackfan Anemia(DBA) Registry comprises patients with mutations in five different RPs: RPS 19,5,26,11,17, together amounting to 67.3% of resolved cases, and making RPS26 the third most mutated gene in Czech DBA patients.
20116044 Mutations in the RPS10 and RPS26 genes in DBA patients affect the function of the proteins in rRNA processing.
15716004 Human recombinant ribosomal protein S26 (rpS26) was shown to interact with its pre-mRNA intron I and mRNA fragment.
12068637 Ribosomal protein binding with the first intron of the human rpS26 pre-mRNA stimulates its interaction with proteins extracted from Hela cells

AA Sequence

MTKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVK      1 - 70
LHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAPRPPPKPM                              71 - 115
//

Text Mined References (41)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24942156 2014 Diamond-Blackfan anemia with mandibulofacial dystostosis is heterogeneous, including the novel DBA genes TSR2 and RPS28.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23728348 2014 The ribosomal protein S26 regulates p53 activity in response to DNA damage.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22951725 2013 Association analyses identify three susceptibility Loci for vitiligo in the Chinese Han population.
More...