Property Summary

NCBI Gene PubMed Count 29
Grant Count 3
R01 Count 2
Funding $700,525.25
PubMed Score 45.77
PubTator Score 26.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.800 0.012

Synonym

Accession P62851 B2R4M7 P25111
Symbols S25

Gene

PDB

4UG0   4V6X   5AJ0   5A2Q   5FLX  

Gene RIF (2)

PMID Text
22777350 data demonstrate that ribosomal protein S25 is a novel regulator of the MDM2-p53 circuit in ribosomal stress; results shed light on biological consequences of RP-MDM2-p53 interplay and also reveal the existence of a novel S25-p53 feedback regulatory loop
22174317 HIV-1 Rev interacting protein, ribosomal protein S25 (RPS25), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MPPKDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITP      1 - 70
AVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA                    71 - 125
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22777350 2013 Identification of ribosomal protein S25 (RPS25)-MDM2-p53 regulatory feedback loop.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21630459 2011 Proteomic characterization of the human sperm nucleus.
More...