Property Summary

NCBI Gene PubMed Count 30
PubMed Score 48.56
PubTator Score 26.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.800 1.2e-02

 GO Function (1)

Gene RIF (3)

AA Sequence

MPPKDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITP      1 - 70
AVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA                    71 - 125
//

Text Mined References (36)

PMID Year Title