Property Summary

NCBI Gene PubMed Count 37
PubMed Score 77.29
PubTator Score 37.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.700 3.2e-03
lung cancer 1.100 7.7e-04
mucosa-associated lymphoid tissue lympho... -1.329 1.9e-02
Multiple myeloma 1.490 4.9e-05
ovarian cancer -1.100 2.2e-04
Waldenstrons macroglobulinemia 1.281 6.3e-03

Gene RIF (8)

AA Sequence

MNDTVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTT      1 - 70
GFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGTAKANVGAGKKPKE            71 - 133
//

Text Mined References (48)

PMID Year Title