Property Summary

NCBI Gene PubMed Count 36
Grant Count 1
Funding $186,410.5
PubMed Score 74.38
PubTator Score 37.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.281 0.006
Multiple myeloma 1.490 0.000
lung cancer 1.100 0.001
diabetes mellitus -1.700 0.003
mucosa-associated lymphoid tissue lympho... -1.329 0.019
ovarian cancer -1.100 0.000

Synonym

Accession P62847 E7EPK6 P16632 Q5T0P7 Q5T0P8 Q7Z3D1
Symbols S24
DBA3

Gene

 Grant Application (1)

PDB

4UG0   4V6X   5AJ0   5A2Q   5FLX  

Gene RIF (7)

PMID Text
26149657 RPS24 gene may be a promising biomarker for therapy in human colon cancer and may have a potential application in the diagnosis or treatment of human colon cancer.
25601189 findings suggest that two rare heterozygous truncating variations (RPS24 Q191X and CD300LF P261fsX266) are risk candidates for autism spectrum disorder.
22944692 Positional proteomics analysis identifies the cleavage of human ribosomal protein S24 (RPS24) at amino acid residues 96-97 by the HIV-1 protease
20378560 Observational study of gene-disease association. (HuGE Navigator)
19773262 Observational study of gene-disease association. (HuGE Navigator)
19689926 Primary fibroblasts from Diamond-Blackfan anemia patients with truncating mutations in RPS19 or in RPS24 have a marked reduction in proliferative capacity.
18230666 Cells from Diamond-Blackfan anemia patients carrying mutations in RPS24 have defective pre-rRNA maturation, as in the case of RPS19 mutations.

AA Sequence

MNDTVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTT      1 - 70
GFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGTAKANVGAGKKPKE            71 - 133
//

Text Mined References (45)

PMID Year Title
26149657 2015 RPS24 knockdown inhibits colorectal cancer cell migration and proliferation in vitro.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25601189 2015 Rare heterozygous truncating variations and risk of autism spectrum disorder: Whole-exome sequencing of a multiplex family and follow-up study in a Japanese population.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
More...