Property Summary

NCBI Gene PubMed Count 28
PubMed Score 154.83
PubTator Score 51.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
diabetes mellitus 1728 1.6e-03
Disease Target Count Z-score Confidence
Diamond-Blackfan anemia 31 3.926 2.0
Insulinoma 24 3.782 1.9
Disease Target Count
Chronic Lymphocytic Leukemia 262

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.400 1.6e-03

Gene RIF (3)

AA Sequence

MAEVEQKKKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKEAPPM      1 - 70
EKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSR     71 - 140
FIPLK                                                                     141 - 145
//

Text Mined References (37)

PMID Year Title