Property Summary

NCBI Gene PubMed Count 28
PubMed Score 147.46
PubTator Score 51.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
diabetes mellitus 1663 0.0015958651724622
Disease Target Count Z-score Confidence
Diamond-Blackfan anemia 30 3.982 2.0
Insulinoma 20 3.829 1.9
Disease Target Count
chronic lymphocytic leukemia 244

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.400 0.002

Synonym

Accession P62841 A5D8V9 P11174 Q3KRA1 Q9UDC2
Symbols RIG
S15

Gene

PDB

4UG0   4V6X   5AJ0   5A2Q   5FLX  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
26675346 we provide novel insights into the heterogeneous genomic landscape of relapsing chronic lymphocytic leukemia and report recurrent mutations in a "hotspot" region of RPS15
24725412 Study shows that ribosomal protein s15 is a key pathogenic LRRK2 substrate in Drosophila and human neuron Parkinson's disease models.
23874713 RPL37, RPS15 and RPS20 regulate the Mdm2-p53-MdmX network but employ different mechanisms to do so.

AA Sequence

MAEVEQKKKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKEAPPM      1 - 70
EKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSR     71 - 140
FIPLK                                                                     141 - 145
//

Text Mined References (35)

PMID Year Title
26824392 2016 Phosphoproteomics reveals that Parkinson's disease kinase LRRK2 regulates a subset of Rab GTPases.
26675346 2016 Whole-exome sequencing in relapsing chronic lymphocytic leukemia: clinical impact of recurrent RPS15 mutations.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23874713 2013 Ribosomal proteins RPL37, RPS15 and RPS20 regulate the Mdm2-p53-MdmX network.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...