Property Summary

NCBI Gene PubMed Count 63
PubMed Score 111.29
PubTator Score 51.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.500 6.8e-05
astrocytic glioma -1.300 2.5e-02
atypical teratoid / rhabdoid tumor -1.800 2.3e-05
Breast cancer 2.400 3.1e-02
ependymoma -1.700 2.5e-02
glioblastoma -1.100 1.9e-04
malignant mesothelioma 1.400 3.0e-06
medulloblastoma, large-cell -1.500 7.6e-05
Multiple myeloma 1.438 1.8e-03
osteosarcoma -1.011 1.2e-04
ovarian cancer 1.400 1.1e-03

Synonym

Accession P62837 D3DQC9 P51669 Q3MN78 Q96RP6
Symbols UBC4
PUBC1
UBCH4
UBC4/5
UBCH5B
E2(17)KB2

Gene

PANTHER Protein Class (1)

PDB

3JVZ   3JW0   5D0K   5D0M   5EDV   5MNJ   5ULF   5ULH   5ULK   5VZW   3A33   3ZNI   4AUQ   4DDG   4DDI   4LDT   4V3K   4V3L   1UR6   1W4U   2CLW   2ESK   2ESO   2ESP   2ESQ   3L1Y   3TGD   4A49   4A4B   4A4C   4WZ3   5D1K   5D1L   5D1M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (6)

Gene RIF (21)

AA Sequence

MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT      1 - 70
TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE     71 - 140
WTQKYAM                                                                   141 - 147
//

Text Mined References (71)

PMID Year Title