Property Summary

NCBI Gene PubMed Count 57
Grant Count 32
R01 Count 25
Funding $1,410,909.55
PubMed Score 107.57
PubTator Score 51.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.438 0.002
malignant mesothelioma 1.400 0.000
astrocytic glioma -1.300 0.025
ependymoma -1.700 0.025
osteosarcoma -1.011 0.000
glioblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.500 0.000
Breast cancer 2.400 0.031
pediatric high grade glioma -1.500 0.000
ovarian cancer 1.400 0.001

Gene RIF (19)

PMID Text
26502057 Data show that ubiquitin E2 enzymes UBE2D1/2/3 and E3 ligase RNF138 accumulate at DNA-damage sites and act at early resection stages by promoting CtIP protein ubiquitylation and accrual.
26475854 mutations having marked effects on function only minimally affect the intermolecular interactions between the AO7 RING and UbcH5B, establishing a high degree of complexity in activation through the RING-E2 interface.
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that UBE2D2 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with UBE2D2
24968937 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that UBE2D2 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with UBE2D2
24906799 together with UBE2L3 and UBE2N, synergistically contribute to Parkin-mediated mitophagy
22902369 Presented is the structure of the human dimeric RING domain from BIRC7 in complex with the E2 UbcH5B covalently linked to Ub.
22190037 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that UBE2D2 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with UBE2D2
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20347421 Whereas UbcH5(A, B and C) is highly efficient in converting IkBa into monoubiquitinated forms, Cdc34 drives ubiquitin (Ub)-Ub conjugation
20152160 determined the 2.2 A crystal structure of an intermediate of UbcH5b approximately ubiquitin (Ub) conjugate, which is assembled into an infinite spiral through the backside interaction.
More...

AA Sequence

MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT      1 - 70
TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE     71 - 140
WTQKYAM                                                                   141 - 147
//

Text Mined References (64)

PMID Year Title
26752685 2016 FIH Regulates Cellular Metabolism through Hydroxylation of the Deubiquitinase OTUB1.
26502057 2015 Systematic E2 screening reveals a UBE2D-RNF138-CtIP axis promoting DNA repair.
26475854 2015 Insights into Ubiquitination from the Unique Clamp-like Binding of the RING E3 AO7 to the E2 UbcH5B.
24906799 2014 The ubiquitin-conjugating enzymes UBE2N, UBE2L3 and UBE2D2/3 are essential for Parkin-dependent mitophagy.
24446487 2014 E2~Ub conjugates regulate the kinase activity of Shigella effector OspG during pathogenesis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23509263 2013 Activity-enhancing mutations in an E3 ubiquitin ligase identified by high-throughput mutagenesis.
22902369 2012 BIRC7-E2 ubiquitin conjugate structure reveals the mechanism of ubiquitin transfer by a RING dimer.
22797923 2012 ZNRF2 is released from membranes by growth factors and, together with ZNRF1, regulates the Na+/K+ATPase.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
More...