Property Summary

Ligand Count 2
NCBI Gene PubMed Count 164
PubMed Score 294.71
PubTator Score 448.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Osteoporosis 363 0.0 3.0
Parkinson's disease 392 0.0 1.2
Disease Target Count Z-score Confidence
Babesiosis 14 4.661 2.3
Hemangioma 69 3.933 2.0
Cancer 2499 3.622 1.8
Disease Target Count
Kabuki syndrome 27

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.400 3.9e-04
atypical teratoid / rhabdoid tumor -1.800 4.4e-07
Breast cancer -1.200 4.7e-14
cystic fibrosis -1.200 5.6e-04
ependymoma -1.200 4.5e-02
glioblastoma -1.200 2.8e-05
hereditary spastic paraplegia -1.076 3.1e-03
invasive ductal carcinoma -1.300 2.3e-04
lung adenocarcinoma -1.800 5.0e-12
medulloblastoma, large-cell -1.500 1.1e-04
non-small cell lung cancer -1.848 6.7e-27
oligodendroglioma -1.300 2.2e-02
psoriasis 1.100 5.6e-03

Protein-protein Interaction (1)

Gene RIF (118)

AA Sequence

MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDCQQCMLEILDTAGTEQFTAMRDL      1 - 70
YMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLARQWCN     71 - 140
CAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKKPKKKSCLLL                              141 - 184
//

Text Mined References (168)

PMID Year Title