Property Summary

NCBI Gene PubMed Count 153
Grant Count 643
R01 Count 462
Funding $53,656,691.8
PubMed Score 288.31
PubTator Score 448.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
ependymoma -1.200 0.045
oligodendroglioma -1.300 0.022
psoriasis 1.100 0.006
glioblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.500 0.000
hereditary spastic paraplegia -1.076 0.003
non-small cell lung cancer -1.848 0.000
cystic fibrosis -1.200 0.001
pediatric high grade glioma -1.500 0.000
lung adenocarcinoma -1.800 0.000
Breast cancer -1.200 0.000
invasive ductal carcinoma -1.300 0.000

Synonym

Accession P62834 P10113
Symbols RAP1
C21KG
G-22K
KREV1
KREV-1
SMGP21

Gene

PDB

1C1Y   1GUA   3KUC   4KVG  

Gene RIF (108)

PMID Text
26280580 RAP1-mediated MEK/ERK pathway defects in Kabuki syndrome.
25963656 Data indicate that through GTPase-activating proteins ArhGAP29 complex formation Rap1 GTP-binding protein spatially restricts Rho-mediated signaling, which is necessary for endothelial barrier potentiation.
25888632 Rap1- and Rac1-GTPase activation have roles in hypoxia/reoxygenation-experienced cancer cell migration and metastasis via the expression of thymosin beta-4
25856570 Our findings suggest that RAP1 may be a useful biomarker for the diagnosis of ical intraepithelial neoplasia .
25636908 These findings provide further evidence that a crucial role for miR-203 in inhibiting metastasis of PCa through the suppression of Rap1A expression.
25631816 A receptor type-protein tyrosine phosphatase alpha-Src family kinase-Rap1 pathway was identified as responsible for recruiting myosin IIB to the zonula adherens in epithelial cells and supporting contractile tension.
25545047 Rap1 knockdown attenuates prostacyclin (PC)-induced vascular endothelial cell (EC) monolayer recovery.
25533468 Phosphorylation of synaptic GTPase-activating protein (synGAP) by Ca2+/calmodulin-dependent protein kinase II (CaMKII) and cyclin-dependent kinase 5 (CDK5) alters the ratio of its GAP activity toward Ras and Rap GTPases.
25028810 basal levels of Rap1 activity holds up cell adhesion, whereas sequential regulation of C3G and GAP by IGF-IR reverses the labile Rap1 function from supporting adhesion to promoting migration.
24980975 By inducing and activating Rap1 and Rac1.
More...

AA Sequence

MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDCQQCMLEILDTAGTEQFTAMRDL      1 - 70
YMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLARQWCN     71 - 140
CAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKKPKKKSCLLL                              141 - 184
//

Text Mined References (157)

PMID Year Title
26280580 2015 RAP1-mediated MEK/ERK pathway defects in Kabuki syndrome.
25963656 2015 Rap1 Spatially Controls ArhGAP29 To Inhibit Rho Signaling during Endothelial Barrier Regulation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25888632 2015 Hypoxia/reoxygenation-experienced cancer cell migration and metastasis are regulated by Rap1- and Rac1-GTPase activation via the expression of thymosin beta-4.
25856570 2015 RAP1 GTPase overexpression is associated with cervical intraepithelial neoplasia.
25636908 2015 MiR-203 down-regulates Rap1A and suppresses cell proliferation, adhesion and invasion in prostate cancer.
25631816 2015 An RPTP?/Src family kinase/Rap1 signaling module recruits myosin IIB to support contractile tension at apical E-cadherin junctions.
25545047 2015 Prostacyclin post-treatment improves LPS-induced acute lung injury and endothelial barrier recovery via Rap1.
25533468 2015 Phosphorylation of synaptic GTPase-activating protein (synGAP) by Ca2+/calmodulin-dependent protein kinase II (CaMKII) and cyclin-dependent kinase 5 (CDK5) alters the ratio of its GAP activity toward Ras and Rap GTPases.
25028810 2014 The small GTPase Rap1 promotes cell movement rather than stabilizes adhesion in epithelial cells responding to insulin-like growth factor I.
More...